Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosylhomocysteinase
LigandBDBM50367250
Substrate/Competitorn/a
Meas. Tech.ChEBML_197214
Ki 4±n/a nM
Citation Houston DMDolence EKKeller BTPatel-Thombre UBorchardt RT Potential inhibitors of S-adenosylmethionine-dependent methyltransferases. 9. 2',3'-Dialdehyde derivatives of carbocyclic purine nucleosides as inhibitors of S-adenosylhomocysteine hydrolase. J Med Chem 28:471-7 (1985) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Adenosylhomocysteinase
Name:Adenosylhomocysteinase
Synonyms:Adenosylhomocysteinase
Type:PROTEIN
Mol. Mass.:47714.06
Organism:Homo sapiens (Human)
Description:ChEMBL_1507791
Residue:432
Sequence:
MSDKLPYKVADIGLAAWGRKALDIAENEMPGLMRMRERYSASKPLKGARIAGCLHMTVET
AVLIETLVTLGAEVQWSSCNIFSTQDHAAAAIAKAGIPVYAWKGETDEEYLWCIEQTLYF
KDGPLNMILDDGGDLTNLIHTKYPQLLPGIRGISEETTTGVHNLYKMMANGILKVPAINV
NDSVTKSKFDNLYGCRESLIDGIKRATDVMIAGKVAVVAGYGDVGKGCAQALRGFGARVI
ITEIDPINALQAAMEGYEVTTMDEACQEGNIFVTTTGCIDIILGRHFEQMKDDAIVCNIG
HFDVEIDVKWLNENAVEKVNIKPQVDRYRLKNGRRIILLAEGRLVNLGCAMGHPSFVMSN
SFTNQVMAQIELWTHPDKYPVGVHFLPKKLDEAVAEAHLGKLNVKLTKLTEKQAQYLGMS
CDGPFKPDHYRY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50367250
n/a
NameBDBM50367250
Synonyms:3-DEAZAARISTEROMYCIN A | CHEMBL268272
TypeSmall organic molecule
Emp. Form.C12H16N4O3
Mol. Mass.264.2804
SMILESNc1nccc2n(cnc12)[C@@H]1C[C@H](CO)[C@@H](O)[C@H]1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: