| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM50011885 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_54441 |
|---|
| IC50 | 72±n/a nM |
|---|
| Citation |  Rosowsky, A; Freisheim, JH; Moran, RG; Solan, VC; Bader, H; Wright, JE; Radike-Smith, M Methotrexate analogues. 26. Inhibition of dihydrofolate reductase and folylpolyglutamate synthetase activity and in vitro tumor cell growth by methotrexate and aminopterin analogues containing a basic amino acid side chain. J Med Chem29:655-60 (1986) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | DYR_MOUSE | Dhfr |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 21608.82 |
|---|
| Organism: | Mus musculus (Mouse) |
|---|
| Description: | n/a |
|---|
| Residue: | 187 |
|---|
| Sequence: | MVRPLNCIVAVSQNMGIGKNGDLPWPPLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPRGAHFLAKSLDDALRLIEQPELASKVDMVWIVGGSS
VYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLGKYKLLPEYPGVLSEVQEEKGIKYKF
EVYEKKD
|
|
|
|---|
| BDBM50011885 |
|---|
| n/a |
|---|
| Name | BDBM50011885 |
|---|
| Synonyms: | 5-Amino-2-{4-[(2,4-diamino-pteridin-6-ylmethyl)-amino]-benzoylamino}-pentanoic acid | CHEMBL280864 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H23N9O3 |
|---|
| Mol. Mass. | 425.4444 |
|---|
| SMILES | NCCCC(NC(=O)c1ccc(NCc2cnc3nc(N)nc(N)c3n2)cc1)C(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
