Reaction Details |
| Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM50019386 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_54441 |
---|
IC50 | 180±n/a nM |
---|
Citation | Rosowsky, A; Freisheim, JH; Moran, RG; Solan, VC; Bader, H; Wright, JE; Radike-Smith, M Methotrexate analogues. 26. Inhibition of dihydrofolate reductase and folylpolyglutamate synthetase activity and in vitro tumor cell growth by methotrexate and aminopterin analogues containing a basic amino acid side chain. J Med Chem29:655-60 (1986) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | DYR_MOUSE | Dhfr |
Type: | Enzyme |
Mol. Mass.: | 21608.82 |
Organism: | Mus musculus (Mouse) |
Description: | n/a |
Residue: | 187 |
Sequence: | MVRPLNCIVAVSQNMGIGKNGDLPWPPLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPRGAHFLAKSLDDALRLIEQPELASKVDMVWIVGGSS
VYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLGKYKLLPEYPGVLSEVQEEKGIKYKF
EVYEKKD
|
|
|
BDBM50019386 |
---|
n/a |
---|
Name | BDBM50019386 |
Synonyms: | 3-Amino-2-{4-[(2,4-diamino-pteridin-6-ylmethyl)-methyl-amino]-benzoylamino}-propionic acid | CHEMBL158478 |
Type | Small organic molecule |
Emp. Form. | C18H21N9O3 |
Mol. Mass. | 411.4178 |
SMILES | CN(Cc1cnc2nc(N)nc(N)c2n1)c1ccc(cc1)C(=O)NC(CN)C(O)=O |
Structure |
|