Reaction Details |
| Report a problem with these data |
Target | Muscarinic receptor M1 |
---|
Ligand | BDBM50018227 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_138126 |
---|
Ki | 2100±n/a nM |
---|
Citation | Leader, H; Smejkal, RM; Payne, CS; Padilla, FN; Doctor, BP; Gordon, RK; Chiang, PK Binary antidotes for organophosphate poisoning: aprophen analogues that are both antimuscarinics and carbamates. J Med Chem32:1522-8 (1989) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Muscarinic receptor M1 |
---|
Name: | Muscarinic receptor M1 |
Synonyms: | Muscarinic acetylcholine receptor M1 |
Type: | PROTEIN |
Mol. Mass.: | 15022.43 |
Organism: | Bos taurus |
Description: | ChEMBL_140161 |
Residue: | 139 |
Sequence: | ETENRARELAALQGSETPGKGGGSSSSSERSQPGAEGSPETPPGRCCRCCRTPRLLQAYS
WKEEEEEDEGSMESLTSSEGEEPGSEVVIKMPMVDPEAQAPAKQPPRSSPNTVKRPTRKG
RERAGKGQKPRGKEQLAKR
|
|
|
BDBM50018227 |
---|
n/a |
---|
Name | BDBM50018227 |
Synonyms: | 2,2-Bis-(4-hydroxy-phenyl)-propionic acid 2-diethylamino-ethyl ester | CHEMBL39342 |
Type | Small organic molecule |
Emp. Form. | C21H27NO4 |
Mol. Mass. | 357.4434 |
SMILES | CCN(CC)CCOC(=O)C(C)(c1ccc(O)cc1)c1ccc(O)cc1 |
Structure |
|