| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50061762 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_201737 (CHEMBL803933) |
|---|
| IC50 | 31±n/a nM |
|---|
| Citation |  Hu, LY; Guo, J; Magar, SS; Fischer, JB; Burke-Howie, KJ; Durant, GJ Synthesis and pharmacological evaluation of N-(2,5-disubstituted phenyl)-N'-(3-substituted phenyl)-N'-methylguanidines as N-methyl-D-aspartate receptor ion-channel blockers. J Med Chem40:4281-9 (1998) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25124.85 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q99720 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
|---|
| BDBM50061762 |
|---|
| n/a |
|---|
| Name | BDBM50061762 |
|---|
| Synonyms: | CHEMBL542730 | N-(2-Chloro-3-ethyl-5-methyl-phenyl)-N'-(3-ethyl-phenyl)-guanidine; hydrochloride |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H22ClN3 |
|---|
| Mol. Mass. | 315.84 |
|---|
| SMILES | CCc1cccc(NC(N)=Nc2cc(C)cc(CC)c2Cl)c1 |w:10.10| |
|---|
| Structure | 
|
|---|
Search and Browse
