| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50084242 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_149021 (CHEMBL758585) |
|---|
| Ki | 10000±n/a nM |
|---|
| Citation |  Zhang, X; Rice, KC; Calderon, SN; Kayakiri, H; Smith, L; Coop, A; Jacobson, AE; Rothman, RB; Davis, P; Dersch, CM; Porreca, F Probes for narcotic receptor mediated phenomena. 26. Synthesis and biological evaluation of diarylmethylpiperazines and diarylmethylpiperidines as novel, nonpeptidic delta opioid receptor ligands. J Med Chem42:5455-63 (2000) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | MOR-1 | MUOR1 | Mu-type opioid receptor (MOR) | OPIATE Mu | OPRM_RAT | Opiate non-selective | Opioid receptor B | Oprm1 | Ror-b |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 44503.11 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the mu opioid receptor. |
|---|
| Residue: | 398 |
|---|
| Sequence: | MDSSTGPGNTSDCSDPLAQASCSPAPGSWLNLSHVDGNQSDPCGLNRTGLGGNDSLCPQT
GSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATST
LPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRT
PRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFA
FIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYV
IIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQ
QNSTRVRQNTREHPSTANTVDRTNHQLENLEAETAPLP
|
|
|
|---|
| BDBM50084242 |
|---|
| n/a |
|---|
| Name | BDBM50084242 |
|---|
| Synonyms: | CHEMBL544638 | N,N-Diethyl-4-[(3-methoxy-phenyl)-piperidin-4-yl-methyl]-benzamide; hydrochloride |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H32N2O2 |
|---|
| Mol. Mass. | 380.5231 |
|---|
| SMILES | CCN(CC)C(=O)c1ccc(cc1)C(C1CCNCC1)c1cccc(OC)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
