Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman immunodeficiency virus type 1 protease
LigandBDBM50092152
Substrate/Competitorn/a
Meas. Tech.ChEMBL_158040
Ki 0.60±n/a nM
Citation Tyndall JDReid RCTyssen DPJardine DKTodd BPassmore MMarch DRPattenden LKBergman DAAlewood DHu SHAlewood PFBirch CJMartin JLFairlie DP Synthesis, stability, antiviral activity, and protease-bound structures of substrate-mimicking constrained macrocyclic inhibitors of HIV-1 protease. J Med Chem 43:3495-504 (2000) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Human immunodeficiency virus type 1 protease
Name:Human immunodeficiency virus type 1 protease
Synonyms:Pol polyprotein
Type:Enzyme Subunit
Mol. Mass.:10781.16
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50092152
n/a
NameBDBM50092152
Synonyms:2-Benzyl-5-(10-sec-butyl-9,12-dioxo-2-oxa-8,11-diaza-bicyclo[13.2.2]nonadeca-1(18),15(19),16-trien-13-ylamino)-4-hydroxy-pentanoic acid (2-hydroxy-indan-1-yl)-amide | CHEMBL331945
TypeSmall organic molecule
Emp. Form.C41H54N4O6
Mol. Mass.698.8907
SMILESCCC(C)[C@@H]1NC(=O)[C@H](Cc2ccc(OCCCCCNC1=O)cc2)NC[C@@H](O)C[C@@H](Cc1ccccc1)C(=O)N[C@@H]1[C@H](O)Cc2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: