| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50083637 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_149624 (CHEMBL758048) |
|---|
| Ki | 2623±n/a nM |
|---|
| Citation |  Thomas, JB; Herault, XM; Rothman, RB; Atkinson, RN; Burgess, JP; Mascarella, SW; Dersch, CM; Xu, H; Flippen-Anderson, JL; George, CF; Carroll, FI Factors influencing agonist potency and selectivity for the opioid delta receptor are revealed in structure-activity relationship studies of the 4-[(N-substituted-4-piperidinyl)arylamino]-N,N-diethylbenzamides. J Med Chem44:972-87 (2001) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | MOR-1 | MUOR1 | Mu-type opioid receptor (MOR) | OPIATE Mu | OPRM_RAT | Opiate non-selective | Opioid receptor B | Oprm1 | Ror-b |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 44503.11 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the mu opioid receptor. |
|---|
| Residue: | 398 |
|---|
| Sequence: | MDSSTGPGNTSDCSDPLAQASCSPAPGSWLNLSHVDGNQSDPCGLNRTGLGGNDSLCPQT
GSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATST
LPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRT
PRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFA
FIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYV
IIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQ
QNSTRVRQNTREHPSTANTVDRTNHQLENLEAETAPLP
|
|
|
|---|
| BDBM50083637 |
|---|
| n/a |
|---|
| Name | BDBM50083637 |
|---|
| Synonyms: | 4-(((3S,4R)-1-allyl-3-methylpiperidin-4-yl)(phenyl)amino)-N,N-diethylbenzamide | 4-[((3S,4R)-1-Allyl-3-methyl-piperidin-4-yl)-phenyl-amino]-N,N-diethyl-benzamide | 4-[(1-Allyl-3-methyl-piperidin-4-yl)-phenyl-amino]-N,N-diethyl-benzamide | CHEMBL22650 | RTI-5989-54 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H35N3O |
|---|
| Mol. Mass. | 405.5756 |
|---|
| SMILES | CCN(CC)C(=O)c1ccc(cc1)N([C@@H]1CCN(CC=C)C[C@@H]1C)c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
