Reaction Details |
| Report a problem with these data |
Target | Chymotrypsinogen A |
---|
Ligand | BDBM50118029 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_49927 (CHEMBL664296) |
---|
IC50 | 22.0±n/a nM |
---|
Citation | Macdonald, SJ; Dowle, MD; Harrison, LA; Clarke, GD; Inglis, GG; Johnson, MR; Shah, P; Smith, RA; Amour, A; Fleetwood, G; Humphreys, DC; Molloy, CR; Dixon, M; Godward, RE; Wonacott, AJ; Singh, OM; Hodgson, ST; Hardy, GW Discovery of further pyrrolidine trans-lactams as inhibitors of human neutrophil elastase (HNE) with potential as development candidates and the crystal structure of HNE complexed with an inhibitor (GW475151). J Med Chem45:3878-90 (2002) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Chymotrypsinogen A |
---|
Name: | Chymotrypsinogen A |
Synonyms: | Alpha-chymotrypsin | CTRA_BOVIN | Chymotrypsin A | Chymotrypsin A chain A | Chymotrypsin A chain B | Chymotrypsin A chain C | Chymotrypsinogen A | alpha-Chymotrypsin (α-Chymotrypsin) |
Type: | Serine protease |
Mol. Mass.: | 25670.88 |
Organism: | Bos taurus (bovine) |
Description: | n/a |
Residue: | 245 |
Sequence: | CGVPAIQPVLSGLSRIVNGEEAVPGSWPWQVSLQDKTGFHFCGGSLINENWVVTAAHCGV
TTSDVVVAGEFDQGSSSEKIQKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTVSA
VCLPSASDDFAAGTTCVTTGWGLTRYTNANTPDRLQQASLPLLSNTNCKKYWGTKIKDAM
ICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCSTSTPGVYARVTALVNWVQQ
TLAAN
|
|
|
BDBM50118029 |
---|
n/a |
---|
Name | BDBM50118029 |
Synonyms: | 3-Isopropyl-1-methanesulfonyl-4-(4-piperidin-1-yl-but-2-enoyl)-hexahydro-pyrrolo[3,2-b]pyrrol-2-one; hydrochloride | CHEMBL2368616 |
Type | Small organic molecule |
Emp. Form. | C19H32ClN3O4S |
Mol. Mass. | 433.993 |
SMILES | Cl.[H][C@@]12CCN(C(=O)\C=C\CN3CCCCC3)[C@@]1([H])[C@H](C(C)C)C(=O)N2S(C)(=O)=O |r| |
Structure |
|