Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeuromedin-K receptor
LigandBDBM50118099
Substrate/Competitorn/a
Meas. Tech.ChEMBL_209569
Ki 9.4±n/a nM
Citation Albert JSAharony DAndisik DBarthlow HBernstein PRBialecki RADedinas RDembofsky BTHill DKirkland KKoether GMKosmider BJOhnmacht CPalmer WPotts WRumsey WShen LShenvi ASherwood SWarwick PJRussell K Design, synthesis, and SAR of tachykinin antagonists: modulation of balance in NK(1)/NK(2) receptor antagonist activity. J Med Chem 45:3972-83 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Neuromedin-K receptor
Name:Neuromedin-K receptor
Synonyms:NK-3 receptor | NK-3R | NKR | Neurokinin 3 receptor | Neurokinin B receptor | Neurokinin-3 (NK-3) | Neuromedin-3 receptor (NK-3R) | Neuromedin-3 receptor (NK3) | Neuromedin-K receptor (NK3) | Tachykinin receptor 3 | Tachykinin receptor 3 (NK3)
Type:Enzyme
Mol. Mass.:52221.96
Organism:Homo sapiens (Human)
Description:P29371
Residue:465
Sequence:
MATLPAAETWIDGGGGVGADAVNLTASLAAGAATGAVETGWLQLLDQAGNLSSSPSALGL
PVASPAPSQPWANLTNQFVQPSWRIALWSLAYGVVVAVAVLGNLIVIWIILAHKRMRTVT
NYFLVNLAFSDASMAAFNTLVNFIYALHSEWYFGANYCRFQNFFPITAVFASIYSMTAIA
VDRYMAIIDPLKPRLSATATKIVIGSIWILAFLLAFPQCLYSKTKVMPGRTLCFVQWPEG
PKQHFTYHIIVIILVYCFPLLIMGITYTIVGITLWGGEIPGDTCDKYHEQLKAKRKVVKM
MIIVVMTFAICWLPYHIYFILTAIYQQLNRWKYIQQVYLASFWLAMSSTMYNPIIYCCLN
KRFRAGFKRAFRWCPFIKVSSYDELELKTTRFHPNRQSSMYTVTRMESMTVVFDPNDADT
TRSSRKKRATPRDPSFNGCSRRNSKSASATSSFISSPYTSVDEYS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50118099
n/a
NameBDBM50118099
Synonyms:1'-[4-[(3-Cyano-2-methoxy-naphthalene-1-carbonyl)-methyl-amino]-3-(3,4-dichloro-phenyl)-butyl]-2-oxo-[1,4']bipiperidinyl-4'-carboxylic acid methylamide | CHEMBL339051
TypeSmall organic molecule
Emp. Form.C36H41Cl2N5O4
Mol. Mass.678.648
SMILESCNC(=O)C1(CCN(CC[C@H](CN(C)C(=O)c2c(OC)c(cc3ccccc23)C#N)c2ccc(Cl)c(Cl)c2)CC1)N1CCCCC1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: