| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Substance-P receptor |
|---|
| Ligand | BDBM50118099 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_205883 (CHEMBL872713) |
|---|
| Ki | 0.27±n/a nM |
|---|
| Citation |  Albert, JS; Aharony, D; Andisik, D; Barthlow, H; Bernstein, PR; Bialecki, RA; Dedinas, R; Dembofsky, BT; Hill, D; Kirkland, K; Koether, GM; Kosmider, BJ; Ohnmacht, C; Palmer, W; Potts, W; Rumsey, W; Shen, L; Shenvi, A; Sherwood, S; Warwick, PJ; Russell, K Design, synthesis, and SAR of tachykinin antagonists: modulation of balance in NK(1)/NK(2) receptor antagonist activity. J Med Chem45:3972-83 (2002) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Substance-P receptor |
|---|
| Name: | Substance-P receptor |
|---|
| Synonyms: | NK-1 receptor | NK-1R | NK1 Receptor | NK1R | NK1R_HUMAN | Neurokinin 1 receptor | Neurokinin-1 (NK-1) | Neuromedin-1 receptor (NK-1R) | SPR | TAC1R | TACR1 | Tachykinin receptor 1 | Tachykinin receptor 1 (NK1) | tachykinin |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 46254.43 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P25103 |
|---|
| Residue: | 407 |
|---|
| Sequence: | MDNVLPVDSDLSPNISTNTSEPNQFVQPAWQIVLWAAAYTVIVVTSVVGNVVVMWIILAH
KRMRTVTNYFLVNLAFAEASMAAFNTVVNFTYAVHNEWYYGLFYCKFHNFFPIAAVFASI
YSMTAVAFDRYMAIIHPLQPRLSATATKVVICVIWVLALLLAFPQGYYSTTETMPSRVVC
MIEWPEHPNKIYEKVYHICVTVLIYFLPLLVIGYAYTVVGITLWASEIPGDSSDRYHEQV
SAKRKVVKMMIVVVCTFAICWLPFHIFFLLPYINPDLYLKKFIQQVYLAIMWLAMSSTMY
NPIIYCCLNDRFRLGFKHAFRCCPFISAGDYEGLEMKSTRYLQTQGSVYKVSRLETTIST
VVGAHEEEPEDGPKATPSSLDLTSNCSSRSDSKTMTESFSFSSNVLS
|
|
|
|---|
| BDBM50118099 |
|---|
| n/a |
|---|
| Name | BDBM50118099 |
|---|
| Synonyms: | 1'-[4-[(3-Cyano-2-methoxy-naphthalene-1-carbonyl)-methyl-amino]-3-(3,4-dichloro-phenyl)-butyl]-2-oxo-[1,4']bipiperidinyl-4'-carboxylic acid methylamide | CHEMBL339051 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C36H41Cl2N5O4 |
|---|
| Mol. Mass. | 678.648 |
|---|
| SMILES | CNC(=O)C1(CCN(CC[C@H](CN(C)C(=O)c2c(OC)c(cc3ccccc23)C#N)c2ccc(Cl)c(Cl)c2)CC1)N1CCCCC1=O |
|---|
| Structure | 
|
|---|
Search and Browse
