| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Delta-type opioid receptor |
|---|
| Ligand | BDBM50002049 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_147183 (CHEMBL754482) |
|---|
| Ki | 3.9±n/a nM |
|---|
| Citation |  Schütz, J; Dersch, CM; Horel, R; Spetea, M; Koch, M; Meditz, R; Greiner, E; Rothman, RB; Schmidhammer, H Synthesis and biological evaluation of 14-alkoxymorphinans. 17. Highly delta opioid receptor selective 14-alkoxy-substituted indolo- and benzofuromorphinans. J Med Chem45:5378-83 (2002) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Delta-type opioid receptor |
|---|
| Name: | Delta-type opioid receptor |
|---|
| Synonyms: | Cytochrome P450 3A4 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor | Delta-type opioid receptor (DOR) | OPIATE Delta | OPRD_RAT | Opiate Delta 1 | Opioid receptor | Opioid receptor A | Opioid receptors; mu & delta | Oprd1 | Ror-a | Voltage-gated potassium channel |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 40465.04 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Competition binding assays were using CHO-K1 cell membranes expressing the opioid receptor. |
|---|
| Residue: | 372 |
|---|
| Sequence: | MEPVPSARAELQFSLLANVSDTFPSAFPSASANASGSPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTQPRDGAVVCTLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRAPCGGQEPGSLRRPRQATARERVTAC
TPSDGPGGGAAA
|
|
|
|---|
| BDBM50002049 |
|---|
| n/a |
|---|
| Name | BDBM50002049 |
|---|
| Synonyms: | CHEMBL608246 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H28N2O3 |
|---|
| Mol. Mass. | 416.5121 |
|---|
| SMILES | [H][C@@]12Cc3ccc(O)c4O[C@@]5(C)c6[nH]c7ccccc7c6C[C@]1(OCC)[C@@]5(CCN2C)c34 |r,TLB:30:29:22:31.3.2| |
|---|
| Structure | 
|
|---|
Search and Browse
