Reaction Details |
| Report a problem with these data |
Target | Carbonic anhydrase 4 |
---|
Ligand | BDBM50292007 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_45265 (CHEMBL658217) |
---|
Ki | 8±n/a nM |
---|
Citation | Scozzafava, A; Menabuoni, L; Mincione, F; Supuran, CT Carbonic anhydrase inhibitors. A general approach for the preparation of water-soluble sulfonamides incorporating polyamino-polycarboxylate tails and of their metal complexes possessing long-lasting, topical intraocular pressure-lowering properties. J Med Chem45:1466-76 (2002) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Carbonic anhydrase 4 |
---|
Name: | Carbonic anhydrase 4 |
Synonyms: | CA-IV | CA4 | CAH4_BOVIN | Carbonate dehydratase IV | Carbonic Anhydrase IV | Carbonic anhydrase | Carbonic anhydrase 4 |
Type: | Enzyme |
Mol. Mass.: | 35152.74 |
Organism: | Bos taurus (bovine) |
Description: | Bovine isozyme, isolated from lung microsomes |
Residue: | 312 |
Sequence: | MRLLLALLVLAAAPPQARAASHWCYQIQVKPSNYTCLEPDEWEGSCQNNRQSPVNIVTAK
TQLDPNLGRFSFSGYNMKHQWVVQNNGHTVMVLLENKPSIAGGGLSTRYQATQLHLHWSR
AMDRGSEHSFDGERFAMEMHIVHEKEKGLSGNASQNQFAEDEIAVLAFMVEDGSKNVNFQ
PLVEALSDIPRPNMNTTMKEGVSLFDLLPEEESLRHYFRYLGSLTTPTCDEKVVWTVFQK
PIQLHRDQILAFSQKLFYDDQQKVNMTDNVRPVQSLGQRQVFRSGAPGLLLAQPLPTLLA
PVLACLTVGFLR
|
|
|
BDBM50292007 |
---|
n/a |
---|
Name | BDBM50292007 |
Synonyms: | CHEMBL1795064 | CHEMBL286828 | {{2-[2-(2-{Carboxymethyl-[(5-sulfamoyl-[1,3,4]thiadiazol-2-ylcarbamoyl)-methyl]-amino}-ethoxy)-ethoxy]-ethyl}-[(5-sulfamoyl-[1,3,4]thiadiazol-2-ylcarbamoyl)-methyl]-amino}-acetic acid | {{2-[2-(2-{Carboxymethyl-[(5-sulfamoyl-[1,3,4]thiadiazol-2-ylcarbamoyl)-methyl]-amino}-ethoxy)-ethoxy]-ethyl}-[(5-sulfamoyl-[1,3,4]thiadiazol-2-ylcarbamoyl)-methyl]-amino}-acetic acid; compound with Al complex | {{2-[2-(2-{Carboxymethyl-[(5-sulfamoyl-[1,3,4]thiadiazol-2-ylcarbamoyl)-methyl]-amino}-ethoxy)-ethoxy]-ethyl}-[(5-sulfamoyl-[1,3,4]thiadiazol-2-ylcarbamoyl)-methyl]-amino}-acetic acid; compound with Cu complex | {{2-[2-(2-{Carboxymethyl-[(5-sulfamoyl-[1,3,4]thiadiazol-2-ylcarbamoyl)-methyl]-amino}-ethoxy)-ethoxy]-ethyl}-[(5-sulfamoyl-[1,3,4]thiadiazol-2-ylcarbamoyl)-methyl]-amino}-acetic acid; compound with Zn complex |
Type | Small organic molecule |
Emp. Form. | C18H28N10O12S4 |
Mol. Mass. | 704.735 |
SMILES | NS(=O)(=O)c1nnc(NC(=O)CN(CCOCCOCCN(CC(O)=O)CC(=O)Nc2nnc(s2)S(N)(=O)=O)CC(O)=O)s1 |
Structure |
|