| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50049806 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_145160 (CHEMBL753420) |
|---|
| Ki | 6.4±n/a nM |
|---|
| Citation |  Anzini, M; Canullo, L; Braile, C; Cappelli, A; Gallelli, A; Vomero, S; Menziani, MC; De Benedetti, PG; Rizzo, M; Collina, S; Azzolina, O; Sbacchi, M; Ghelardini, C; Galeotti, N Synthesis, biological evaluation, and receptor docking simulations of 2-[(acylamino)ethyl]-1,4-benzodiazepines as kappa-opioid receptor agonists endowed with antinociceptive and antiamnesic activity. J Med Chem46:3853-64 (2003) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50049806 |
|---|
| n/a |
|---|
| Name | BDBM50049806 |
|---|
| Synonyms: | CHEMBL127969 | Thiophene-2-carboxylic acid [2-(1-methyl-5-phenyl-2,3-dihydro-1H-benzo[e][1,4]diazepin-2-yl)-ethyl]-amide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H23N3OS |
|---|
| Mol. Mass. | 389.513 |
|---|
| SMILES | CN1C(CCNC(=O)c2cccs2)CN=C(c2ccccc2)c2ccccc12 |t:15| |
|---|
| Structure | 
|
|---|
Search and Browse
