Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCaM kinase II
LigandBDBM50133058
Substrate/Competitorn/a
Meas. Tech.ChEMBL_43095
IC50>10000±n/a nM
Citation Kuo GHProuty CDeAngelis AShen LO'Neill DJShah CConnolly PJMurray WVConway BRCheung PWestover LXu JZLook RADemarest KTEmanuel SMiddleton SAJolliffe LBeavers MPChen X Synthesis and discovery of macrocyclic polyoxygenated bis-7-azaindolylmaleimides as a novel series of potent and highly selective glycogen synthase kinase-3beta inhibitors. J Med Chem 46:4021-31 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
CaM kinase II
Name:CaM kinase II
Synonyms:n/a
Type:n/a
Mol. Mass.:n/a
Description:ASSAY_ID of ChEMBL is 368599
Components:This complex has 4 components.
Component 1
Name:CAMK2A
Synonyms:CaM kinase II | CaM kinase II alpha | Calcium/calmodulin-dependent protein kinase type II subunit alpha (CAMK2a)
Type:Enzyme Catalytic Domain
Mol. Mass.:54093.63
Organism:Homo sapiens (Human)
Description:gi_25952118
Residue:478
Sequence:
MATITCTRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLERE
ARICRLLKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQIL
EAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVEGEQQAWFGFAGTPGYL
SPEVLRKDPYGKPVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTV
TPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVDCLKKFNARRKLK
GAILTTMLATRNFSGGKSGGNKKSDGVKESSESTNTTIEDEDTKVRKQEIIKVTEQLIEA
ISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKPVHTTILNPHIH
LMGDESACIAYIRITQYLDAGGIPRTAQSEETRVWHRRDGKWQIVHFHRSGAPSVLPH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:CaM kinase II
Synonyms:CaM kinase II gamma | Calcium/calmodulin-dependent protein kinase type II subunit gamma (CAMKllg)
Type:Protein
Mol. Mass.:62621.56
Organism:Homo sapiens (Human)
Description:Q13555
Residue:558
Sequence:
MATTATCTRFTDDYQLFEELGKGAFSVVRRCVKKTSTQEYAAKIINTKKLSARDHQKLER
EARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQI
LESVNHIHQHDIVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGEQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDT
VTPEAKNLINQMLTINPAKRITADQALKHPWVCQRSTVASMMHRQETVECLRKFNARRKL
KGAILTTMLVSRNFSAAKSLLNKKSDGGVKKRKSSSSVHLMPQSNNKNSLVSPAQEPAPL
QTAMEPQTTVVHNATDGIKGSTESCNTTTEDEDLKARSPEGRSSRDRTAPSAGMQPQPSL
CSSAMRKQEIIKITEQLIEAINNGDFEAYTKICDPGLTSFEPEALGNLVEGMDFHKFYFE
NLLSKNSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDG
KWLNVHYHCSGAPAAPLQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 3
Name:CAMK2B
Synonyms:CaM kinase II | CaM kinase II beta | CaM kinase II subunit beta | CaM-kinase II beta chain | CaMK-II subunit beta | Calcium/calmodulin-dependent protein kinase type II | Calcium/calmodulin-dependent protein kinase type II beta chain
Type:Enzyme Catalytic Domain
Mol. Mass.:72685.48
Organism:Homo sapiens (Human)
Description:gi_26051204
Residue:666
Sequence:
MATTVTCTRFTDEYQLYEDIGKGAFSVVRRCVKLCTGHEYAAKIINTKKLSARDHQKLER
EARICRLLKHSNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQI
LEAVLHCHQMGVVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKEAYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDT
VTPEAKNLINQMLTINPAKRITAHEALKHPWVCQRSTVASMMHRQETVECLKKFNARRKL
KGAILTTMLATRNFSVGRQTTAPATMSTAASGTTMGLVEQAKSLLNKKADGVKPQTNSTK
NSAAATSPKGTLPPAALEPQTTVIHNPVDGIKESSDSANTTIEDEDAKAPRVPDILSSVR
RGSGAPEAEGPLPCPSPAPFSPLPAPSPRISDILNSVRRGSGTPEAEGPLSAGPPPCLSP
ALLGPLSSPSPRISDILNSVRRGSGTPEAEGPSPVGPPPCPSPTIPGPLPTPSRKQEIIK
TTEQLIEAVNNGDFEAYAKICDPGLTSFEPEALGNLVEGMDFHRFYFENLLAKNSKPIHT
TILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWQNVHFHCSGA
PVAPLQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 4
Name:Calcium/calmodulin-dependent protein kinase type II subunit delta
Synonyms:CAMK2D | CAMKD | CaM kinase II | CaM kinase II delta | CaMK-II subunit delta | Calcium/calmodulin-dependent protein kinase type II subunit delta (CaMKII subunit delta)
Type:Enzyme
Mol. Mass.:56375.82
Organism:Homo sapiens (Human)
Description:Q13557
Residue:499
Sequence:
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLER
EARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQI
LESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDT
VTPEAKDLINKMLTINPAKRITASEALKHPWICQRSTVASMMHRQETVDCLKKFNARRKL
KGAILTTMLATRNFSAAKSLLKKPDGVKESTESSNTTIEDEDVKARKQEIIKVTEQLIEA
INNGDFEAYTKICDPGLTAFEPEALGNLVEGMDFHRFYFENALSKSNKPIHTIILNPHVH
LVGDDAACIAYIRLTQYMDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSGSPTVPIKPP
CIPNGKENFSGGTSLWQNI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50133058
n/a
NameBDBM50133058
Synonyms:17,20,23,26-tetraoxa-4,12,14,29,31-pentaazahexacyclo[27.6.1.17,14.02,6.08,13.030,35]heptatriaconta-1(36),2(6),7(37),8,10,12,30,32,34-nonaene-3,5-dione | CHEMBL337642
TypeSmall organic molecule
Emp. Form.C28H29N5O6
Mol. Mass.531.5598
SMILESO=C1NC(=O)C2=C1c1cn(CCOCCOCCOCCOCCn3cc2c2cccnc32)c2ncccc12 |c:5|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: