Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistamine receptor (H3)
LigandBDBM22904
Substrate/Competitorn/a
Meas. Tech.ChEMBL_83641
Ki 2.7±n/a nM
Citation Zaragoza FStephensen HKnudsen SMPridal LWulff BSRimvall K 1-alkyl-4-acylpiperazines as a new class of imidazole-free histamine H(3) receptor antagonists. J Med Chem 47:2833-8 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histamine receptor (H3)
Name:Histamine receptor (H3 and H4)
Synonyms:G-protein coupled receptor 97 | HH3R | HISTAMINE H3 | HRH3 | Histamine H3 Receptor | Histamine H3 receptor (H3) | Histamine H3L | Histamine receptor (H3 and H4)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:48691.47
Organism:Homo sapiens (Human)
Description:Binding assays were using CHO cells stably expressing hH3R receptors.
Residue:445
Sequence:
MERAPPDGPLNASGALAGEAAAAGGARGFSAAWTAVLAALMALLIVATVLGNALVMLAFV
ADSSLRTQNNFFLLNLAISDFLVGAFCIPLYVPYVLTGRWTFGRGLCKLWLVVDYLLCTS
SAFNIVLISYDRFLSVTRAVSYRAQQGDTRRAVRKMLLVWVLAFLLYGPAILSWEYLSGG
SSIPEGHCYAEFFYNWYFLITASTLEFFTPFLSVTFFNLSIYLNIQRRTRLRLDGAREAA
GPEPPPEAQPSPPPPPGCWGCWQKGHGEAMPLHRYGVGEAAVGAEAGEATLGGGGGGGSV
ASPTSSSGSSSRGTERPRSLKRGSKPSASSASLEKRMKMVSQSFTQRFRLSRDRKVAKSL
AVIVSIFGLCWAPYTLLMIIRAACHGHCVPDYWYETSFWLLWANSAVNPVLYPLCHHSFR
RAFTKLLCPQKLKIQPHSSLEHCWK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22904
n/a
NameBDBM22904
Synonyms:(2R)-1-(1H-imidazol-5-yl)propan-2-amine | (R)-alpha-Methylhistamine | Alpha-Methylhistamine-R | Alpha-Methylhistane-R | CHEMBL268229 | R-alpha-methylhistamine | RAMH
TypeSmall organic molecule
Emp. Form.C6H11N3
Mol. Mass.125.1716
SMILESC[C@@H](N)Cc1cnc[nH]1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: