Reaction Details |
| Report a problem with these data |
Target | Mu-type opioid receptor |
---|
Ligand | BDBM21015 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_146966 (CHEMBL758124) |
---|
EC50 | 414±n/a nM |
---|
Citation | Ananthan, S; Khare, NK; Saini, SK; Seitz, LE; Bartlett, JL; Davis, P; Dersch, CM; Porreca, F; Rothman, RB; Bilsky, EJ Identification of opioid ligands possessing mixed micro agonist/delta antagonist activity among pyridomorphinans derived from naloxone, oxymorphone, and hydromorphone [correction of hydropmorphone]. J Med Chem47:1400-12 (2004) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Mu-type opioid receptor |
---|
Name: | Mu-type opioid receptor |
Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 11165.58 |
Organism: | GUINEA PIG |
Description: | P97266 |
Residue: | 98 |
Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
BDBM21015 |
---|
n/a |
---|
Name | BDBM21015 |
Synonyms: | (2S)-2-{2-[(2R)-2-[(2S)-2-amino-3-(4-hydroxyphenyl)propanamido]propanamido]-N-methylacetamido}-N-(2-hydroxyethyl)-3-phenylpropanamide | 2-Ala-4-MePhe-5-Gly-Enkephalin | CHEMBL38874 | D-Ala2-MePhe4-Met(0)5-enkephalin-ol | DAMGO | RX 783006 | US11492374, ID 2 | [3H]DAMGO | [tyrosyl-3,5-3H(N)]-D-Ala2-Mephe4-glyol5-enkephalin |
Type | Analgesics |
Emp. Form. | C26H35N5O6 |
Mol. Mass. | 513.586 |
SMILES | C[C@@H](NC(=O)[C@@H](N)Cc1ccc(O)cc1)C(=O)NCC(=O)N(C)[C@@H](Cc1ccccc1)C(=O)NCCO |
Structure |
|