Reaction Details |
| Report a problem with these data |
Target | Delta-type opioid receptor |
---|
Ligand | BDBM50153121 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_303251 (CHEMBL826377) |
---|
Ki | >2000±n/a nM |
---|
Citation | Goehring, RR; Whitehead, JF; Brown, K; Islam, K; Wen, X; Zhou, X; Chen, Z; Valenzano, KJ; Miller, WS; Shan, S; Kyle, DJ 1,3-Dihydro-2,1,3-benzothiadiazol-2,2-diones and 3,4-dihydro-1H-2,1,3-benzothidiazin-2,2-diones as ligands for the NOP receptor. Bioorg Med Chem Lett14:5045-50 (2004) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Delta-type opioid receptor |
---|
Name: | Delta-type opioid receptor |
Synonyms: | D-OR-1 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRD_HUMAN | OPRK1 | opioid receptor, delta 1 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 40382.98 |
Organism: | Homo sapiens (Human) |
Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor. |
Residue: | 372 |
Sequence: | MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
|
|
|
BDBM50153121 |
---|
n/a |
---|
Name | BDBM50153121 |
Synonyms: | 1-[1-(4-Isopropyl-cyclohexyl)-piperidin-4-yl]-3,4-dihydro-1H-benzo[1,2,6]thiadiazine 2,2-dioxide | CHEMBL184127 | Cis-1-[1-(4-Isopropyl-cyclohexyl)-piperidin-4-yl]-3,4-dihydro-1H-benzo[1,2,6]thiadiazine 2,2-dioxide | Trans-1-[1-(4-Isopropyl-cyclohexyl)-piperidin-4-yl]-3,4-dihydro-1H-benzo[1,2,6]thiadiazine 2,2-dioxide |
Type | Small organic molecule |
Emp. Form. | C21H33N3O2S |
Mol. Mass. | 391.571 |
SMILES | CC(C)C1CCC(CC1)N1CCC(CC1)N1c2ccccc2CNS1(=O)=O |(7.68,-3.52,;7.37,-2.01,;8.54,-.99,;5.92,-1.52,;4.78,-2.53,;3.31,-2.06,;3,-.55,;4.15,.48,;5.61,-.01,;1.55,-.05,;1.24,1.44,;-.23,1.92,;-1.37,.89,;-1.05,-.62,;.41,-1.1,;-2.82,1.37,;-3.81,.18,;-3.27,-1.27,;-4.23,-2.46,;-5.77,-2.21,;-6.31,-.77,;-5.35,.44,;-5.89,1.87,;-4.9,3.06,;-3.37,2.81,;-1.84,2.96,;-3.52,4.37,)| |
Structure |
|