| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Non-structural protein 4A |
|---|
| Ligand | BDBM50158808 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_305030 (CHEMBL831669) |
|---|
| IC50 | 200±n/a nM |
|---|
| Citation |  Gordon, CP; Keller, PA Control of hepatitis C: a medicinal chemistry perspective. J Med Chem48:1-20 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Non-structural protein 4A |
|---|
| Name: | Non-structural protein 4A |
|---|
| Synonyms: | Hepatitis C virus NS4A protein | Hepatitis C virus serine protease, NS3/NS4A | Non-structural protein 4A |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 5762.65 |
|---|
| Organism: | Hepatitis C virus |
|---|
| Description: | ChEMBL_305334 |
|---|
| Residue: | 54 |
|---|
| Sequence: | STWVLLGGVLAALAAYCLSVGCVVIVGYIELGGKPALVPDKEVCYQQYDEMEEC
|
|
|
|---|
| BDBM50158808 |
|---|
| n/a |
|---|
| Name | BDBM50158808 |
|---|
| Synonyms: | CHEMBL408166 | Cys-Val-Val-Ile-Val-Gly-Arg-Ile-Val-Leu-Ser-Gly-Lys |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C60H111N17O15S |
|---|
| Mol. Mass. | 1342.693 |
|---|
| SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CCCN=C(N)N)NC(=O)CNC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](N)CS)C(C)C)C(C)C)[C@@H](C)CC)C(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CCCCN)C(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
