Reaction Details |
| Report a problem with these data |
Target | Non-structural protein 4A |
---|
Ligand | BDBM50158824 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_305334 (CHEMBL833555) |
---|
IC50 | 200±n/a nM |
---|
Citation | Gordon, CP; Keller, PA Control of hepatitis C: a medicinal chemistry perspective. J Med Chem48:1-20 (2005) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Non-structural protein 4A |
---|
Name: | Non-structural protein 4A |
Synonyms: | Hepatitis C virus NS4A protein | Hepatitis C virus serine protease, NS3/NS4A | Non-structural protein 4A |
Type: | PROTEIN |
Mol. Mass.: | 5762.65 |
Organism: | Hepatitis C virus |
Description: | ChEMBL_305334 |
Residue: | 54 |
Sequence: | STWVLLGGVLAALAAYCLSVGCVVIVGYIELGGKPALVPDKEVCYQQYDEMEEC
|
|
|
BDBM50158824 |
---|
n/a |
---|
Name | BDBM50158824 |
Synonyms: | CHEMBL438893 | Lys-Gly-Ser-Leu-Val-Ile-Arg-Gly-Val-Ile-Val-Val-Cys-Lys |
Type | Small organic molecule |
Emp. Form. | C66H123N19O16S |
Mol. Mass. | 1470.866 |
SMILES | CC[C@H](C)[C@H](NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)CNC(=O)[C@@H](N)CCCCN)C(C)C)C(=O)N[C@@H](CCCN=C(N)N)C(=O)NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCCCN)C(O)=O |
Structure |
|