Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSomatostatin receptor type 2
LigandBDBM50370582
Substrate/Competitorn/a
Meas. Tech.ChEMBL_302670
Ki>0.07±n/a nM
Citation Neelamkavil SArison BBirzin EFeng JJChen KHLin ACheng FCTaylor LThornton ERSmith ABHirschmann R Replacement of Phe6, Phe7, and Phe11 of D-Trp8-somatostatin-14 with L-pyrazinylalanine. Predicted and observed effects on binding affinities at hSST2 and hSST4. An unexpected effect of the chirality of Trp8 on NMR spectra in methanol. J Med Chem 48:4025-30 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Somatostatin receptor type 2
Name:Somatostatin receptor type 2
Synonyms:SOMATOSTATIN SST2 | SRIF-1 | SS-2-R | SS2-R | SS2R | SSTR2 | Somatostatin receptor type 2 (SSTR2)
Type:Enzyme
Mol. Mass.:41344.94
Organism:Homo sapiens (Human)
Description:P30874
Residue:369
Sequence:
MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCG
NTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMT
VDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIY
AGLRSNQWGRSSCTINWPGESGAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGI
RVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPALKGMFDFVVVL
TYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTL
LNGDLQTSI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50370582
n/a
NameBDBM50370582
Synonyms:CHEMBL1791306
TypeSmall organic molecule
Emp. Form.C76H104N18O19S2
Mol. Mass.1637.878
SMILESC[C@H](O)[C@H]1NC(=O)[C@H](Cc2ccccc2)NC(=O)[C@H](NC(=O)[C@@H](CCCCN)NC(=O)[C@H](Cc2c[nH]c3ccccc23)NC(=O)[C@@H](Cc2ccccc2)NC(=O)[C@H](Cc2ccccc2)NC(=O)[C@@H](CC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CSSC[C@H](NC(=O)[C@H](CO)NC1=O)C(O)=O)NC(=O)CNC(=O)[C@H](C)N)[C@H](C)O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: