| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Ileal sodium/bile acid cotransporter |
|---|
| Ligand | BDBM50172661 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_321562 (CHEMBL882493) |
|---|
| IC50 | 2.2±n/a nM |
|---|
| Citation |  Huang, HC; Tremont, SJ; Lee, LF; Keller, BT; Carpenter, AJ; Wang, CC; Banerjee, SC; Both, SR; Fletcher, T; Garland, DJ; Huang, W; Jones, C; Koeller, KJ; Kolodziej, SA; Li, J; Manning, RE; Mahoney, MW; Miller, RE; Mischke, DA; Rath, NP; Reinhard, EJ; Tollefson, MB; Vernier, WF; Wagner, GM; Rapp, SR; Beaudry, J; Glenn, K; Regina, K; Schuh, JR; Smith, ME; Trivedi, JS; Reitz, DB Discovery of potent, nonsystemic apical sodium-codependent bile acid transporter inhibitors (Part 2). J Med Chem48:5853-68 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Ileal sodium/bile acid cotransporter |
|---|
| Name: | Ileal sodium/bile acid cotransporter |
|---|
| Synonyms: | ASBT | Apical sodium-dependent bile acid transporter | IBAT | ISBT | Ileal Na(+)/bile acid cotransporter | Ileal bile acid transporter | Ileal bile acid transporter/bile acid cotransporter | Ileal sodium-dependent bile acid transporter | NTCP2 | NTCP2_HUMAN | SLC10A2 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 37714.89 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | SLC10A2 |
|---|
| Residue: | 348 |
|---|
| Sequence: | MNDPNSCVDNATVCSGASCVVPESNFNNILSVVLSTVLTILLALVMFSMGCNVEIKKFLG
HIKRPWGICVGFLCQFGIMPLTGFILSVAFDILPLQAVVVLIIGCCPGGTASNILAYWVD
GDMDLSVSMTTCSTLLALGMMPLCLLIYTKMWVDSGSIVIPYDNIGTSLVSLVVPVSIGM
FVNHKWPQKAKIILKIGSIAGAILIVLIAVVGGILYQSAWIIAPKLWIIGTIFPVAGYSL
GFLLARIAGLPWYRCRTVAFETGMQNTQLCSTIVQLSFTPEELNVVFTFPLIYSIFQLAF
AAIFLGFYVAYKKCHGKNKAEIPESKENGTEPESSFYKANGGFQPDEK
|
|
|
|---|
| BDBM50172661 |
|---|
| n/a |
|---|
| Name | BDBM50172661 |
|---|
| Synonyms: | (4R,5R)-3,3-Dibutyl-7-dimethylamino-5-(4-hydroxy-phenyl)-1,1-dioxo-2,3,4,5-tetrahydro-1H-1lambda*6*-benzo[b]thiepin-4-ol | CHEMBL194461 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H37NO4S |
|---|
| Mol. Mass. | 459.641 |
|---|
| SMILES | CCCCC1(CCCC)CS(=O)(=O)c2ccc(cc2[C@H]([C@H]1O)c1ccc(O)cc1)N(C)C |
|---|
| Structure | 
|
|---|
Search and Browse
