Reaction Details |
| Report a problem with these data |
Target | Ileal sodium/bile acid cotransporter |
---|
Ligand | BDBM50172690 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_321562 (CHEMBL882493) |
---|
IC50 | 2.3±n/a nM |
---|
Citation | Huang, HC; Tremont, SJ; Lee, LF; Keller, BT; Carpenter, AJ; Wang, CC; Banerjee, SC; Both, SR; Fletcher, T; Garland, DJ; Huang, W; Jones, C; Koeller, KJ; Kolodziej, SA; Li, J; Manning, RE; Mahoney, MW; Miller, RE; Mischke, DA; Rath, NP; Reinhard, EJ; Tollefson, MB; Vernier, WF; Wagner, GM; Rapp, SR; Beaudry, J; Glenn, K; Regina, K; Schuh, JR; Smith, ME; Trivedi, JS; Reitz, DB Discovery of potent, nonsystemic apical sodium-codependent bile acid transporter inhibitors (Part 2). J Med Chem48:5853-68 (2005) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Ileal sodium/bile acid cotransporter |
---|
Name: | Ileal sodium/bile acid cotransporter |
Synonyms: | ASBT | Apical sodium-dependent bile acid transporter | IBAT | ISBT | Ileal Na(+)/bile acid cotransporter | Ileal bile acid transporter | Ileal bile acid transporter/bile acid cotransporter | Ileal sodium-dependent bile acid transporter | NTCP2 | NTCP2_HUMAN | SLC10A2 |
Type: | Enzyme |
Mol. Mass.: | 37714.89 |
Organism: | Homo sapiens (Human) |
Description: | SLC10A2 |
Residue: | 348 |
Sequence: | MNDPNSCVDNATVCSGASCVVPESNFNNILSVVLSTVLTILLALVMFSMGCNVEIKKFLG
HIKRPWGICVGFLCQFGIMPLTGFILSVAFDILPLQAVVVLIIGCCPGGTASNILAYWVD
GDMDLSVSMTTCSTLLALGMMPLCLLIYTKMWVDSGSIVIPYDNIGTSLVSLVVPVSIGM
FVNHKWPQKAKIILKIGSIAGAILIVLIAVVGGILYQSAWIIAPKLWIIGTIFPVAGYSL
GFLLARIAGLPWYRCRTVAFETGMQNTQLCSTIVQLSFTPEELNVVFTFPLIYSIFQLAF
AAIFLGFYVAYKKCHGKNKAEIPESKENGTEPESSFYKANGGFQPDEK
|
|
|
BDBM50172690 |
---|
n/a |
---|
Name | BDBM50172690 |
Synonyms: | (Carboxymethyl-{5-[4-((4R,5R)-3,3-dibutyl-7-dimethylamino-4-hydroxy-1,1-dioxo-2,3,4,5-tetrahydro-1H-1lambda*6*-benzo[b]thiepin-5-yl)-phenoxy]-pentyl}-amino)-acetic acid | CHEMBL196032 |
Type | Small organic molecule |
Emp. Form. | C35H52N2O8S |
Mol. Mass. | 660.861 |
SMILES | CCCCC1(CCCC)CS(=O)(=O)c2ccc(cc2[C@H]([C@H]1O)c1ccc(OCCCCCN(CC(O)=O)CC(O)=O)cc1)N(C)C |
Structure |
|