Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A1
LigandBDBM21216
Substrate/Competitorn/a
Meas. Tech.ChEMBL_325560
Ki 0.5±n/a nM
Citation Novellino ECosimelli BEhlardo MGreco GIadanza MLavecchia ARimoli MGSala ADa Settimo APrimofiore GDa Settimo FTaliani SLa Motta CKlotz KNTuscano DTrincavelli MLMartini C 2-(Benzimidazol-2-yl)quinoxalines: a novel class of selective antagonists at human A(1) and A(3) adenosine receptors designed by 3D database searching. J Med Chem 48:8253-60 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptor A1
Name:Adenosine receptor A1/Alpha-2A adrenergic receptor
Synonyms:A1 adenosine receptor (hA1) | A1AR | ADENOSINE A1 | ADORA1 | Adenosine A1 receptor (A1AR) | Adenosine A1-receptor | Adenosine receptor A1 (A1) | Adenosine receptor A1 (hA1) | Adenosine transporter (AdT)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:36520.92
Organism:Homo sapiens (Human)
Description:P30542
Residue:326
Sequence:
MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVT
PRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFL
KIWNDHFRCQPAPPIDEDLPEERPDD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM21216
n/a
NameBDBM21216
Synonyms:2-[4-(ethylsulfanyl)-1H-1,3-benzodiazol-2-yl]quinoxaline | 2-[4-(ethylsulfanyl)-1H-benzimidazol-2-yl]quinoxaline | CHEMBL198008 | benzimidazole-quinoxaline, C2
TypeSmall organic molecule
Emp. Form.C17H14N4S
Mol. Mass.306.385
SMILESCCSc1cccc2nc([nH]c12)-c1cnc2ccccc2n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: