| Reaction Details |
|---|
 | Report a problem with these data |
| Target | C-C chemokine receptor type 2 |
|---|
| Ligand | BDBM50190516 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_373786 (CHEMBL869750) |
|---|
| IC50 | >10000±n/a nM |
|---|
| Citation |  Habashita, H; Kokubo, M; Hamano, S; Hamanaka, N; Toda, M; Shibayama, S; Tada, H; Sagawa, K; Fukushima, D; Maeda, K; Mitsuya, H Design, synthesis, and biological evaluation of the combinatorial library with a new spirodiketopiperazine scaffold. Discovery of novel potent and selective low-molecular-weight CCR5 antagonists. J Med Chem49:4140-52 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| C-C chemokine receptor type 2 |
|---|
| Name: | C-C chemokine receptor type 2 |
|---|
| Synonyms: | C-C chemokine receptor type 2 (CCR2) | CCR2 | CCR2_HUMAN | CMKBR2 | Chemoattractant Cytokine Receptor 2 (CCR2) | Chemokine Receptor Type 2b (CCR2b) | Monocyte chemotactic protein-1 (MCP-1) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 41932.32 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P41597 |
|---|
| Residue: | 374 |
|---|
| Sequence: | MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGAQLLPPLYSLVFIFGFVGN
MLVVLILINCKKLKCLTDIYLLNLAISDLLFLITLPLWAHSAANEWVFGNAMCKLFTGLY
HIGYFGGIFFIILLTIDRYLAIVHAVFALKARTVTFGVVTSVITWLVAVFASVPGIIFTK
CQKEDSVYVCGPYFPRGWNNFHTIMRNILGLVLPLLIMVICYSGILKTLLRCRNEKKRHR
AVRVIFTIMIVYFLFWTPYNIVILLNTFQEFFGLSNCESTSQLDQATQVTETLGMTHCCI
NPIIYAFVGEKFRSLFHIALGCRIAPLQKPVCGGPGVRPGKNVKVTTQGLLDGRGKGKSI
GRAPEASLQDKEGA
|
|
|
|---|
| BDBM50190516 |
|---|
| n/a |
|---|
| Name | BDBM50190516 |
|---|
| Synonyms: | (RS)-1-butyl-3-(cyclohexylmethyl)-9-(4-phenoxybenzyl)-1,4,9-triazaspiro[5.5]undecane-2,5-dione hydrochloride | 1-butyl-3-cyclohexylmethyl-9-(4-phenoxy-benzyl)-1,4,9-triaza-spiro[5.5]undecane-2,5-dione hydrochloride | 1-butyl-3-cyclohexylmethyl-9-(4-phenoxyphenylmethyl)-1,4,9-triazaspiro[5.5]undeca-2,5-dione hydrochloride | CHEMBL536743 | rac-1-Butyl-3-(cyclohexylmethyl)-9-(4-phenoxybenzyl)-1,4,9-triazaspiro[5.5]undecane-2,5-dione hydrochloride |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C32H43N3O3 |
|---|
| Mol. Mass. | 517.7021 |
|---|
| SMILES | CCCCN1C(=O)C(CC2CCCCC2)NC(=O)C11CCN(Cc2ccc(Oc3ccccc3)cc2)CC1 |
|---|
| Structure | 
|
|---|
Search and Browse
