| Reaction Details |
|---|
 | Report a problem with these data |
| Target | GNAT family acetyltransferase |
|---|
| Ligand | BDBM50193475 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_385423 (CHEMBL869194) |
|---|
| Ki | 1.2±n/a nM |
|---|
| Citation |  Gao, F; Yan, X; Shakya, T; Baettig, OM; Ait-Mohand-Brunet, S; Berghuis, AM; Wright, GD; Auclair, K Synthesis and structure-activity relationships of truncated bisubstrate inhibitors of aminoglycoside 6'-N-acetyltransferases. J Med Chem49:5273-81 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| GNAT family acetyltransferase |
|---|
| Name: | GNAT family acetyltransferase |
|---|
| Synonyms: | Aminoglycoside acetyltransferase |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 21017.80 |
|---|
| Organism: | Enterococcus durans |
|---|
| Description: | ChEMBL_385423 |
|---|
| Residue: | 183 |
|---|
| Sequence: | MIISEFDRDNLVLRDQLADLLRLTWPDEYGEQPMKEVERLLEDERIAVSAIEGDELIGFV
GAIPQYGQTGWELHPLVVESMYRKQQVGTRLVSYLEKEIASQGGIVVYLGTDDVEGQTSL
AIEEDLFEDTFDKLETIQNRKDHPYEFYEKLGYQIVGVIPDANGWNKPDIWMAKRIARKH
GSE
|
|
|
|---|
| BDBM50193475 |
|---|
| n/a |
|---|
| Name | BDBM50193475 |
|---|
| Synonyms: | (3R)-3-{[2-({2-[({[(1S)-1-carbamoyl-4-[(diaminomethylidene)amino]butyl]carbamoyl}methyl)sulfanyl]ethyl}carbamoyl)ethyl]carbamoyl}-3-hydroxy-2,2-dimethylpropyl ({[(2R,3S,4R,5R)-5-(6-amino-9H-purin-9-yl)-4-hydroxy-3-(phosphonatooxy)oxolan-2-yl]methyl phosphonato}oxy)phosphonate | CID44415025 | truncated aminoglycoside-coenzyme A bisubstrate analogue 4c |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C29H47N12O18P3S |
|---|
| Mol. Mass. | 976.742 |
|---|
| SMILES | [#6]C([#6])([#6]-[#8]P([#8-])(=O)[#8]P([#8-])(=O)[#8]-[#6]-[#6@H]-1-[#8]-[#6@H](-[#6@H](-[#8])-[#6@@H]-1-[#8]P([#8-])([#8-])=O)-n1cnc2c(-[#7])ncnc12)[#6@@H](-[#8])-[#6](=O)-[#7]-[#6]-[#6]-[#6](=O)-[#7]-[#6]-[#6]-[#16]-[#6]-[#6](=O)-[#7]-[#6@@H](-[#6]-[#6]-[#6]\[#7]=[#6](\[#7])-[#7])-[#6](-[#7])=O |
|---|
| Structure | 
|
|---|
Search and Browse
