| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Prostaglandin E2 receptor EP1 subtype |
|---|
| Ligand | BDBM50193919 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_424226 (CHEMBL909000) |
|---|
| Ki | 6700±n/a nM |
|---|
| Citation |  Belley, M; Chan, CC; Gareau, Y; Gallant, M; Juteau, H; Houde, K; Lachance, N; Labelle, M; Sawyer, N; Tremblay, N; Lamontagne, S; Carrière, MC; Denis, D; Greig, GM; Slipetz, D; Gordon, R; Chauret, N; Li, C; Zamboni, RJ; Metters, KM Comparison between two classes of selective EP(3) antagonists and their biological activities. Bioorg Med Chem Lett16:5639-42 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Prostaglandin E2 receptor EP1 subtype |
|---|
| Name: | Prostaglandin E2 receptor EP1 subtype |
|---|
| Synonyms: | PE2R1_HUMAN | PGE receptor, EP1 subtype | PTGER1 | Prostaglandin E2 receptor | Prostaglandin E2 receptor EP1 subtype | Prostaglandin E2 receptor EP1 subtype (EP1) | Prostanoid EP1 receptor |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 41834.57 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P34995 |
|---|
| Residue: | 402 |
|---|
| Sequence: | MSPCGPLNLSLAGEATTCAAPWVPNTSAVPPSGASPALPIFSMTLGAVSNLLALALLAQA
AGRLRRRRSAATFLLFVASLLATDLAGHVIPGALVLRLYTAGRAPAGGACHFLGGCMVFF
GLCPLLLGCGMAVERCVGVTRPLLHAARVSVARARLALAAVAAVALAVALLPLARVGRYE
LQYPGTWCFIGLGPPGGWRQALLAGLFASLGLVALLAALVCNTLSGLALLRARWRRRSRR
PPPASGPDSRRRWGAHGPRSASASSASSIASASTFFGGSRSSGSARRARAHDVEMVGQLV
GIMVVSCICWSPMLVLVALAVGGWSSTSLQRPLFLAVRLASWNQILDPWVYILLRQAVLR
QLLRLLPPRAGAKGGPAGLGLTPSAWEASSLRSSRHSGLSHF
|
|
|
|---|
| BDBM50193919 |
|---|
| n/a |
|---|
| Name | BDBM50193919 |
|---|
| Synonyms: | 3-(2-(3-(2-(benzyloxy)-5-methylphenyl)propyl)phenyl)-N-(thiophen-2-ylsulfonyl)propanamide | CHEMBL220821 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C30H31NO4S2 |
|---|
| Mol. Mass. | 533.701 |
|---|
| SMILES | Cc1ccc(OCc2ccccc2)c(CCCc2ccccc2CCC(=O)NS(=O)(=O)c2cccs2)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
