Reaction Details |
| Report a problem with these data |
Target | Prostaglandin E2 receptor EP1 subtype |
---|
Ligand | BDBM50193919 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_424226 (CHEMBL909000) |
---|
Ki | 6700±n/a nM |
---|
Citation | Belley, M; Chan, CC; Gareau, Y; Gallant, M; Juteau, H; Houde, K; Lachance, N; Labelle, M; Sawyer, N; Tremblay, N; Lamontagne, S; Carrière, MC; Denis, D; Greig, GM; Slipetz, D; Gordon, R; Chauret, N; Li, C; Zamboni, RJ; Metters, KM Comparison between two classes of selective EP(3) antagonists and their biological activities. Bioorg Med Chem Lett16:5639-42 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Prostaglandin E2 receptor EP1 subtype |
---|
Name: | Prostaglandin E2 receptor EP1 subtype |
Synonyms: | PE2R1_HUMAN | PGE receptor, EP1 subtype | PTGER1 | Prostaglandin E2 receptor | Prostaglandin E2 receptor EP1 subtype | Prostaglandin E2 receptor EP1 subtype (EP1) | Prostanoid EP1 receptor |
Type: | Enzyme |
Mol. Mass.: | 41834.57 |
Organism: | Homo sapiens (Human) |
Description: | P34995 |
Residue: | 402 |
Sequence: | MSPCGPLNLSLAGEATTCAAPWVPNTSAVPPSGASPALPIFSMTLGAVSNLLALALLAQA
AGRLRRRRSAATFLLFVASLLATDLAGHVIPGALVLRLYTAGRAPAGGACHFLGGCMVFF
GLCPLLLGCGMAVERCVGVTRPLLHAARVSVARARLALAAVAAVALAVALLPLARVGRYE
LQYPGTWCFIGLGPPGGWRQALLAGLFASLGLVALLAALVCNTLSGLALLRARWRRRSRR
PPPASGPDSRRRWGAHGPRSASASSASSIASASTFFGGSRSSGSARRARAHDVEMVGQLV
GIMVVSCICWSPMLVLVALAVGGWSSTSLQRPLFLAVRLASWNQILDPWVYILLRQAVLR
QLLRLLPPRAGAKGGPAGLGLTPSAWEASSLRSSRHSGLSHF
|
|
|
BDBM50193919 |
---|
n/a |
---|
Name | BDBM50193919 |
Synonyms: | 3-(2-(3-(2-(benzyloxy)-5-methylphenyl)propyl)phenyl)-N-(thiophen-2-ylsulfonyl)propanamide | CHEMBL220821 |
Type | Small organic molecule |
Emp. Form. | C30H31NO4S2 |
Mol. Mass. | 533.701 |
SMILES | Cc1ccc(OCc2ccccc2)c(CCCc2ccccc2CCC(=O)NS(=O)(=O)c2cccs2)c1 |
Structure |
|