| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Enoyl-[acyl-carrier-protein] reductase [NADH] FabI |
|---|
| Ligand | BDBM50223363 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_450121 (CHEMBL900393) |
|---|
| IC50 | >32000±n/a nM |
|---|
| Citation |  Ozawa, T; Kitagawa, H; Yamamoto, Y; Takahata, S; Iida, M; Osaki, Y; Yamada, K Phenylimidazole derivatives as specific inhibitors of bacterial enoyl-acyl carrier protein reductase FabK. Bioorg Med Chem15:7325-36 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Enoyl-[acyl-carrier-protein] reductase [NADH] FabI |
|---|
| Name: | Enoyl-[acyl-carrier-protein] reductase [NADH] FabI |
|---|
| Synonyms: | Enoyl - (acyl carrier protein) reductase | Enoyl-ACP Reductase (FabI) | Enoyl-[acyl-carrier-protein] reductase | Enoyl-acyl carrier protein reductase (FabI) | FABI_ECOLI | NADH-dependent enoyl-ACP reductase | envM | fabI |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 27861.12 |
|---|
| Organism: | Escherichia coli |
|---|
| Description: | n/a |
|---|
| Residue: | 262 |
|---|
| Sequence: | MGFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIV
LQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDIS
SYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPE
GVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGI
SGEVVHVDGGFSIAAMNELELK
|
|
|
|---|
| BDBM50223363 |
|---|
| n/a |
|---|
| Name | BDBM50223363 |
|---|
| Synonyms: | 4-(2-(3-((4-phenyl-1H-imidazol-2-yl)methyl)ureido)thiazol-5-ylthio)benzoic acid | CHEMBL235273 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H17N5O3S2 |
|---|
| Mol. Mass. | 451.521 |
|---|
| SMILES | OC(=O)c1ccc(Sc2cnc(NC(=O)NCc3nc(c[nH]3)-c3ccccc3)s2)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
