| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cathepsin G |
|---|
| Ligand | BDBM50069989 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_464561 (CHEMBL933247) |
|---|
| IC50 | 520±n/a nM |
|---|
| Citation |  Dorsey, BD; Iqbal, M; Chatterjee, S; Menta, E; Bernardini, R; Bernareggi, A; Cassarà, PG; D'Arasmo, G; Ferretti, E; De Munari, S; Oliva, A; Pezzoni, G; Allievi, C; Strepponi, I; Ruggeri, B; Ator, MA; Williams, M; Mallamo, JP Discovery of a potent, selective, and orally active proteasome inhibitor for the treatment of cancer. J Med Chem51:1068-72 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cathepsin G |
|---|
| Name: | Cathepsin G |
|---|
| Synonyms: | CATG_HUMAN | CG | CTSG |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 28860.08 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_1469016 |
|---|
| Residue: | 255 |
|---|
| Sequence: | MQPLLLLLAFLLPTGAEAGEIIGGRESRPHSRPYMAYLQIQSPAGQSRCGGFLVREDFVL
TAAHCWGSNINVTLGAHNIQRRENTQQHITARRAIRHPQYNQRTIQNDIMLLQLSRRVRR
NRNVNPVALPRAQEGLRPGTLCTVAGWGRVSMRRGTDTLREVQLRVQRDRQCLRIFGSYD
PRRQICVGDRRERKAAFKGDSGGPLLCNNVAHGIVSYGKSSGVPPEVFTRVSSFLPWIRT
TMRSFKLLDQMETPL
|
|
|
|---|
| BDBM50069989 |
|---|
| n/a |
|---|
| Name | BDBM50069989 |
|---|
| Synonyms: | (R)-3-methyl-1-((S)-3-phenyl-2-(pyrazine-2-carboxamido)propanamido)butylboronic acid | (R)-3-methyl-1-((S)-3-phenyl-2-(pyrazine-6-carboxamido)propanamido)butylboronic acid | BORTEZOMIB | CHEMBL325041 | Dipeptidyl boronic acid derivative | LDP-341 | N-[(1R)-1-(DIHYDROXYBORYL)-3-METHYLBUTYL]-N-(PYRAZIN-2-YLCARBONYL)-L-PHENYLALANINAMIDE | PS-341 | Peptidyl boronic acid derivative | US11542283, Compound Velcade | Velcade | cid_387447 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H25BN4O4 |
|---|
| Mol. Mass. | 384.237 |
|---|
| SMILES | CC(C)C[C@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)c1cnccn1)B(O)O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
