Reaction Details |
| Report a problem with these data |
Target | Chymase |
---|
Ligand | BDBM50069989 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_464567 (CHEMBL933253) |
---|
IC50 | 1190±n/a nM |
---|
Citation | Dorsey, BD; Iqbal, M; Chatterjee, S; Menta, E; Bernardini, R; Bernareggi, A; Cassarà, PG; D'Arasmo, G; Ferretti, E; De Munari, S; Oliva, A; Pezzoni, G; Allievi, C; Strepponi, I; Ruggeri, B; Ator, MA; Williams, M; Mallamo, JP Discovery of a potent, selective, and orally active proteasome inhibitor for the treatment of cancer. J Med Chem51:1068-72 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Chymase |
---|
Name: | Chymase |
Synonyms: | Alpha-chymase | CMA1 | CMA1_HUMAN | CYH | CYM | Chymase precursor | Mast cell protease I |
Type: | Enzyme |
Mol. Mass.: | 27340.12 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 247 |
Sequence: | MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNF
VLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKA
SLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRD
FDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWI
NQILQAN
|
|
|
BDBM50069989 |
---|
n/a |
---|
Name | BDBM50069989 |
Synonyms: | (R)-3-methyl-1-((S)-3-phenyl-2-(pyrazine-2-carboxamido)propanamido)butylboronic acid | (R)-3-methyl-1-((S)-3-phenyl-2-(pyrazine-6-carboxamido)propanamido)butylboronic acid | BORTEZOMIB | CHEMBL325041 | Dipeptidyl boronic acid derivative | LDP-341 | N-[(1R)-1-(DIHYDROXYBORYL)-3-METHYLBUTYL]-N-(PYRAZIN-2-YLCARBONYL)-L-PHENYLALANINAMIDE | PS-341 | Peptidyl boronic acid derivative | US11542283, Compound Velcade | Velcade | cid_387447 |
Type | Small organic molecule |
Emp. Form. | C19H25BN4O4 |
Mol. Mass. | 384.237 |
SMILES | CC(C)C[C@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)c1cnccn1)B(O)O |r| |
Structure |
|