Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKCNQ (Kv7) potassium channel
LigandBDBM50212239
Substrate/Competitorn/a
Meas. Tech.ChEMBL_466479
IC50>10000±n/a nM
Citation Jarvis MFHonore PShieh CCChapman MJoshi SZhang XFKort MCarroll WMarron BAtkinson RThomas JLiu DKrambis MLiu YMcGaraughty SChu KRoeloffs RZhong CMikusa JPHernandez GGauvin DWade CZhu CPai MScanio MShi LDrizin IGregg RMatulenko MHakeem AGross MJohnson MMarsh KWagoner PKSullivan JPFaltynek CRKrafte DS A-803467, a potent and selective Nav1.8 sodium channel blocker, attenuates neuropathic and inflammatory pain in the rat. Proc Natl Acad Sci USA 104:8520-5 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
KCNQ (Kv7) potassium channel
Name:KCNQ (Kv7) potassium channel
Synonyms:Voltage-gated potassium channel subunit Kv7.3
Type:PROTEIN
Mol. Mass.:96759.41
Organism:Homo sapiens (Human)
Description:ChEMBL_938652
Residue:872
Sequence:
MGLKARRAAGAAGGGGDGGGGGGGAANPAGGDAAAAGDEERKVGLAPGDVEQVTLALGAG
ADKDGTLLLEGGGRDEGQRRTPQGIGLLAKTPLSRPVKRNNAKYRRIQTLIYDALERPRG
WALLYHALVFLIVLGCLILAVLTTFKEYETVSGDWLLLLETFAIFIFGAEFALRIWAAGC
CCRYKGWRGRLKFARKPLCMLDIFVLIASVPVVAVGNQGNVLATSLRSLRFLQILRMLRM
DRRGGTWKLLGSAICAHSKELITAWYIGFLTLILSSFLVYLVEKDVPEVDAQGEEMKEEF
ETYADALWWGLITLATIGYGDKTPKTWEGRLIAATFSLIGVSFFALPAGILGSGLALKVQ
EQHRQKHFEKRRKPAAELIQAAWRYYATNPNRIDLVATWRFYESVVSFPFFRKEQLEAAS
SQKLGLLDRVRLSNPRGSNTKGKLFTPLNVDAIEESPSKEPKPVGLNNKERFRTAFRMKA
YAFWQSSEDAGTGDPMAEDRGYGNDFPIEDMIPTLKAAIRAVRILQFRLYKKKFKETLRP
YDVKDVIEQYSAGHLDMLSRIKYLQTRIDMIFTPGPPSTPKHKKSQKGSAFTFPSQQSPR
NEPYVARPSTSEIEDQSMMGKFVKVERQVQDMGKKLDFLVDMHMQHMERLQVQVTEYYPT
KGTSSPAEAEKKEDNRYSDLKTIICNYSETGPPEPPYSFHQVTIDKVSPYGFFAHDPVNL
PRGGPSSGKVQATPPSSATTYVERPTVLPILTLLDSRVSCHSQADLQGPYSDRISPRQRR
SITRDSDTPLSLMSVNHEELERSPSGFSISQDRDDYVFGPNGGSSWMREKRYLAEGETDT
DTDPFTPSGSMPLSSTGDGISDSVWTPSNKPI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50212239
n/a
NameBDBM50212239
Synonyms:5-(4-chlorophenyl)-N-(3,5-dimethoxyphenyl)furan-2-carboxamide | A-803467 | CHEMBL250699
TypeSmall organic molecule
Emp. Form.C19H16ClNO4
Mol. Mass.357.788
SMILESCOc1cc(NC(=O)c2ccc(o2)-c2ccc(Cl)cc2)cc(OC)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: