| Reaction Details |
|---|
 | Report a problem with these data |
| Target | G-protein coupled bile acid receptor 1 |
|---|
| Ligand | BDBM50375575 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_472949 (CHEMBL949256) |
|---|
| EC50 | 47800±n/a nM |
|---|
| Citation |  Sato, H; Macchiarulo, A; Thomas, C; Gioiello, A; Une, M; Hofmann, AF; Saladin, R; Schoonjans, K; Pellicciari, R; Auwerx, J Novel potent and selective bile acid derivatives as TGR5 agonists: biological screening, structure-activity relationships, and molecular modeling studies. J Med Chem51:1831-41 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| G-protein coupled bile acid receptor 1 |
|---|
| Name: | G-protein coupled bile acid receptor 1 |
|---|
| Synonyms: | BG37 | GPBAR1 | GPBAR_HUMAN | M-BAR | TGR5 | hBG37 | hGPCR19 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 35260.02 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | CHO cells transiently transfected with hTGR5. |
|---|
| Residue: | 330 |
|---|
| Sequence: | MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLA
GLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQP
PGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGA
AAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPY
VATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQ
GLWGRASRDSPGPSIAYHPSSQSSVDLDLN
|
|
|
|---|
| BDBM50375575 |
|---|
| n/a |
|---|
| Name | BDBM50375575 |
|---|
| Synonyms: | CHEMBL270493 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H45NO8S2 |
|---|
| Mol. Mass. | 563.767 |
|---|
| SMILES | C[C@H](CCC(=O)NCCS(O)(=O)=O)[C@H]1CC[C@H]2[C@@H]3CC[C@@H]4C[C@@H](CC[C@]4(C)[C@H]3CC[C@]12C)OS(O)(=O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
