Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCannabinoid receptor 2
LigandBDBM50272234
Substrate/Competitorn/a
Meas. Tech.ChEMBL_510484
EC50 0.13±n/a nM
Citation Cheng YAlbrecht BKBrown JBuchanan JLBuckner WHDiMauro EFEmkey RFremeau RTHarmange JCHoffman BJHuang LHuang MLee JHLin FFMartin MWNguyen HQPatel VFTomlinson SAWhite RDXia XHitchcock SA Discovery and optimization of a novel series of N-arylamide oxadiazoles as potent, highly selective and orally bioavailable cannabinoid receptor 2 (CB2) agonists. J Med Chem 51:5019-34 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cannabinoid receptor 2
Name:Cannabinoid receptor 2
Synonyms:CANNABINOID CB2 | CB-2 | CB2 | CNR2 | Cannabinoid CB2 receptor | Cannabinoid receptor | rCB2
Type:Enzyme
Mol. Mass.:39366.68
Organism:Rattus norvegicus (Rat)
Description:Q9QZN9
Residue:360
Sequence:
MAGCRELELTNGSNGGLEFNPMKEYMILSDAQQIAVAVLCTLMGLLSALENVAVLYLILS
SQRLRRKPSYLFIGSLAGADFLASVIFACNFVIFHVFHGVDSRNIFLLKIGSVTMTFTAS
VGSLLLTAVDRYLCLCYPPTYKALVTRGRALVALGVMWVLSALISYLPLMGWTCCPSPCS
ELFPLIPNDYLLGWLLFIAILFSGIIYTYGYVLWKAHQHVASLAEHQDRQVPGIARMRLD
VRLAKTLGLVMAVLLICWFPALALMGHSLVTTLSDKVKEAFAFCSMLCLVNSMINPIIYA
LRSGEIRSAAQHCLTGWKKYLQGLGSEGKEEAPKSSVTETEAEVKTTTGPGSRTPGCSNC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50272234
n/a
NameBDBM50272234
Synonyms:3-(3-(2-Cyano-4-fluorophenyl)-1,2,4-oxadiazol-5-yl)-N-(9-ethyl-9H-carbazol-3-yl)propanamide | CHEMBL499324
TypeSmall organic molecule
Emp. Form.C26H20FN5O2
Mol. Mass.453.4677
SMILESCCn1c2ccccc2c2cc(NC(=O)CCc3nc(no3)-c3ccc(F)cc3C#N)ccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: