Reaction Details |
| Report a problem with these data |
Target | Translocator protein |
---|
Ligand | BDBM50253930 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_511514 (CHEMBL980957) |
---|
Ki | 3.6±n/a nM |
---|
Citation | Da Settimo, F; Simorini, F; Taliani, S; La Motta, C; Marini, AM; Salerno, S; Bellandi, M; Novellino, E; Greco, G; Cosimelli, B; Da Pozzo, E; Costa, B; Simola, N; Morelli, M; Martini, C Anxiolytic-like effects of N,N-dialkyl-2-phenylindol-3-ylglyoxylamides by modulation of translocator protein promoting neurosteroid biosynthesis. J Med Chem51:5798-806 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Translocator protein |
---|
Name: | Translocator protein |
Synonyms: | Benzodiazepine receptors; peripheral & central | Bzrp | Mbr | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR) | Peripheral-Type Benzodiazepine Receptor | TSPO_RAT | Tspo |
Type: | Mitochondrion membrane protein |
Mol. Mass.: | 18945.84 |
Organism: | Rattus norvegicus (rat) |
Description: | Competitive binding experiments were performed on rat kidney mitochondrial membranes. |
Residue: | 169 |
Sequence: | MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
|
|
|
BDBM50253930 |
---|
n/a |
---|
Name | BDBM50253930 |
Synonyms: | 2-(5-chloro-2-phenyl-1H-indol-3-yl)-N-methyl-2-oxo-N-pentylacetamide | CHEMBL460157 |
Type | Small organic molecule |
Emp. Form. | C22H23ClN2O2 |
Mol. Mass. | 382.883 |
SMILES | CCCCCN(C)C(=O)C(=O)c1c([nH]c2ccc(Cl)cc12)-c1ccccc1 |
Structure |
|