Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHydroxycarboxylic acid receptor 2
LigandBDBM50277670
Substrate/Competitorn/a
Meas. Tech.ChEMBL_501319
IC50 1300±n/a nM
Citation Imbriglio JEChang SLiang RRaghavan SSchmidt DSmenton ATria SSchrader TOJung JKEsser CTaggart AKCheng KCarballo-Jane EGerard Waters MTata JRColletti SL GPR109a agonists. Part 1: 5-Alkyl and 5-aryl-pyrazole-tetrazoles as agonists of the human orphan G-protein coupled receptor GPR109a. Bioorg Med Chem Lett 19:2121-4 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Hydroxycarboxylic acid receptor 2
Name:Hydroxycarboxylic acid receptor 2
Synonyms:HM74 nicotinic acid GPCR
Type:PROTEIN
Mol. Mass.:41418.01
Organism:Mus musculus
Description:ChEMBL_820676
Residue:360
Sequence:
MSKSDHFLVINGKNCCVFRDENIAKVLPPVLGLEFVFGLLGNGLALWIFCFHLKSWKSSR
IFLFNLAVADFLLIICLPFLTDNYVHNWDWRFGGIPCRVMLFMLAMNRQGSIIFLTVVAV
DRYFRVVHPHHFLNKISNRTAAIISCFLWGLTIGLTVHLLYTNMMTKNGEAYLCSSFSIC
YNFRWHDAMFLLEFFLPLAIILFCSGRIIWSLRQRQMDRHAKIKRAINFIMVVAIVFIIC
FLPSVAVRIRIFWLLYKYNVRNCDIYSSVDLAFFTTLSFTYMNSMLDPVVYYFSSPSFPN
FFSTCINRCLRKKTLGEPDNNRSTSVELTGDPSTTRSIPGALMADPSEPGSPPYLASTSR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50277670
n/a
NameBDBM50277670
Synonyms:5-ethyl-3-(1H-tetrazol-5-yl)-1,4,5,6-tetrahydrocyclopenta[c]pyrazole | CHEMBL519338
TypeSmall organic molecule
Emp. Form.C9H12N6
Mol. Mass.204.2318
SMILESCCC1Cc2[nH]nc(-c3nnn[nH]3)c2C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: