| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cathepsin D |
|---|
| Ligand | BDBM50302846 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_595447 (CHEMBL1045212) |
|---|
| IC50 | 3.3±n/a nM |
|---|
| Citation |  Sealy, JM; Truong, AP; Tso, L; Probst, GD; Aquino, J; Hom, RK; Jagodzinska, BM; Dressen, D; Wone, DW; Brogley, L; John, V; Tung, JS; Pleiss, MA; Tucker, JA; Konradi, AW; Dappen, MS; Toth, G; Pan, H; Ruslim, L; Miller, J; Bova, MP; Sinha, S; Quinn, KP; Sauer, JM Design and synthesis of cell potent BACE-1 inhibitors: structure-activity relationship of P1' substituents. Bioorg Med Chem Lett19:6386-91 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cathepsin D |
|---|
| Name: | Cathepsin D |
|---|
| Synonyms: | CATD_HUMAN | CPSD | CTSD | Cathepsin D [Precursor] | Cathepsin D heavy chain | Cathepsin D light chain | Cathepsin D precursor |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 44551.72 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Human proCathepsin D (SwissProt accession number P07339) was expressed in Sf9 cells, purified, and autoactivated. |
|---|
| Residue: | 412 |
|---|
| Sequence: | MQPSSLLPLALCLLAAPASALVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVP
AVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIH
HKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFG
EATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQ
PGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSL
MVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQ
AGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL
|
|
|
|---|
| BDBM50302846 |
|---|
| n/a |
|---|
| Name | BDBM50302846 |
|---|
| Synonyms: | CHEMBL570165 | benzyl 3-((2R,3S)-3-acetamido-4-(3,5-difluorophenyl)-2-hydroxybutylamino)-3-(3-tert-butylphenyl)piperidine-1-carboxylate |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C35H43F2N3O4 |
|---|
| Mol. Mass. | 607.7304 |
|---|
| SMILES | CC(=O)N[C@@H](Cc1cc(F)cc(F)c1)[C@H](O)CNC1(CCCN(C1)C(=O)OCc1ccccc1)c1cccc(c1)C(C)(C)C |r| |
|---|
| Structure | 
|
|---|
Search and Browse
