| Reaction Details |
|---|
 | Report a problem with these data |
| Target | RAC-alpha serine/threonine-protein kinase |
|---|
| Ligand | BDBM50326053 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_587065 (CHEMBL1051279) |
|---|
| Kd | 950±n/a nM |
|---|
| Citation |  Karaman, MW; Herrgard, S; Treiber, DK; Gallant, P; Atteridge, CE; Campbell, BT; Chan, KW; Ciceri, P; Davis, MI; Edeen, PT; Faraoni, R; Floyd, M; Hunt, JP; Lockhart, DJ; Milanov, ZV; Morrison, MJ; Pallares, G; Patel, HK; Pritchard, S; Wodicka, LM; Zarrinkar, PP A quantitative analysis of kinase inhibitor selectivity. Nat Biotechnol26:127-32 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| RAC-alpha serine/threonine-protein kinase |
|---|
| Name: | RAC-alpha serine/threonine-protein kinase |
|---|
| Synonyms: | AKT phosphorylation (p-AKT) | AKT1 | AKT1/PPP1CA | AKT1_HUMAN | C-AKT | PKB | PKB alpha | Protein kinase Akt-1 | Protein kinase B | Protein kinase B (AKT1) | Protein kinase B (Akt 1) | Protein kinase B (Akt) | Protein kinase B alpha | Protein kinase B alpha (AKT1) | Proto-oncogene Akt (Akt1) | Proto-oncogene c-Akt (AKT) | Proto-oncogene c-Akt (AKT1) | RAC | RAC-PK-alpha | RAC-alpha serine/threonine-protein kinase (AKT) | RAC-alpha serine/threonine-protein kinase (AKT1) | RAC-alpha serine/threonine-protein kinase (pAKT) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 55681.25 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P31749 |
|---|
| Residue: | 480 |
|---|
| Sequence: | MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKKQEEEEMDF
RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKK
LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA
|
|
|
|---|
| BDBM50326053 |
|---|
| n/a |
|---|
| Name | BDBM50326053 |
|---|
| Synonyms: | CHEMBL608533 | PKC-412 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C35H30N4O4 |
|---|
| Mol. Mass. | 570.6371 |
|---|
| SMILES | CO[C@@H]1[C@@H](C[C@H]2O[C@]1(C)n1c3ccccc3c3c4CNC(=O)c4c4c5ccccc5n2c4c13)N(C)C(=O)c1ccccc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
