Reaction Details |
| Report a problem with these data |
Target | Serine/threonine-protein kinase Nek6 |
---|
Ligand | BDBM4814 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_586711 (CHEMBL1062858) |
---|
Kd | >10000±n/a nM |
---|
Citation | Karaman, MW; Herrgard, S; Treiber, DK; Gallant, P; Atteridge, CE; Campbell, BT; Chan, KW; Ciceri, P; Davis, MI; Edeen, PT; Faraoni, R; Floyd, M; Hunt, JP; Lockhart, DJ; Milanov, ZV; Morrison, MJ; Pallares, G; Patel, HK; Pritchard, S; Wodicka, LM; Zarrinkar, PP A quantitative analysis of kinase inhibitor selectivity. Nat Biotechnol26:127-32 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Serine/threonine-protein kinase Nek6 |
---|
Name: | Serine/threonine-protein kinase Nek6 |
Synonyms: | NEK kinase | NEK6 | NEK6_HUMAN |
Type: | PROTEIN |
Mol. Mass.: | 35724.53 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_1446777 |
Residue: | 313 |
Sequence: | MAGQPGHMPHGGSSNNLCHTLGPVHPPDPQRHPNTLSFRCSLADFQIEKKIGRGQFSEVY
KATCLLDRKTVALKKVQIFEMMDAKARQDCVKEIGLLKQLNHPNIIKYLDSFIEDNELNI
VLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHSRRVMHRDIKPANVFI
TATGVVKLGDLGLGRFFSSETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEM
AALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCICPDPHQRPDIGYVH
QVAKQMHIWMSST
|
|
|
BDBM4814 |
---|
n/a |
---|
Name | BDBM4814 |
Synonyms: | CHEMBL535 | N-[2-(diethylamino)ethyl]-5-[(Z)-(5-fluoro-2-oxo-1,2-dihydro-3H-indol-3-ylidene)methyl]-2,4-dimethyl-1H-pyrrole-3-carboxamide | N-[2-(diethylamino)ethyl]-5-{[(3Z)-5-fluoro-2-oxo-2,3-dihydro-1H-indol-3-ylidene]methyl}-2,4-dimethyl-1H-pyrrole-3-carboxamide | SU11248 | SUNITINIB | SUNITINIB MALATE | US10464902, Sunitinib | US20240058459, Compound Sunit-inib | US9163010, Sunitinib | US9914707, SU11248 |
Type | Small organic molecule |
Emp. Form. | C22H27FN4O2 |
Mol. Mass. | 398.4738 |
SMILES | CCN(CC)CCNC(=O)c1c(C)[nH]c(\C=C2/C(=O)Nc3ccc(F)cc23)c1C |
Structure |
|