Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEcto-5'-nucleotidase (e5'NT)
LigandBDBM50336785
Substrate/Competitorn/a
Meas. Tech.ChEMBL_612633
Ki 1660±n/a nM
Citation Baqi YLee SYIqbal JRipphausen PLehr AScheiff ABZimmermann HBajorath JMüller CE Development of potent and selective inhibitors of ecto-5'-nucleotidase based on an anthraquinone scaffold. J Med Chem 53:2076-86 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Ecto-5'-nucleotidase (e5'NT)
Name:Ecto-5'-nucleotidase (e5'NT)
Synonyms:5'-nucleotidase | Ecto-5-nucleotidase (e5'NT) | NT
Type:Enzyme
Mol. Mass.:63971.44
Organism:Rattus norvegicus (Rat)
Description:P21588
Residue:576
Sequence:
MRPAAATAPKWLLLALSALLPLWPTAKSWELTIMHTNDVHSRLEQTSDDSTKCLNASLCV
GGVARLFTKVQQIRKEEPNVLLLDAGDQYQGTIWFTVYKGLEVAHFMNLLGYDAMALGNH
EFDNGVEGLIDPLLRNVKFPILSANIKARGPLAPQISGLYLPYKVLSVGGEVVGIVGYTS
KETPFLSNPGTNLVFEDEVTALQPEVDKLKTLNVNKIIALGHSGFEMDKLIAQKVRGVDV
VVGGHTNTFLYTGNPPSKEVPAGKYPFIVTSDDGRKVPVVQAYAFGKYLGYLKVEFDDKG
NVVTSYGNPILLNSTIREDAAIKADINQWRIKLDNYSTQELGRTIVYLNGSAQECRFREC
NMGNLICDAMINNNLRHPDEMFWNHVSMCIVNGGGIRSPIDERNNGTITWENLAAVLPFG
GTFDLVQLKGSTLKKAFEHSVHRYGQSTGEFLQVGGIHVVYDISRKPWDRVVQLKVLCTK
CRVPIYEPLEMDKVYKVVLPSYLVNGGDGFQMIKDELLKHDSGDQDISVVSEYISKMKVI
YPAVEGRIKFSAASHYQGSFPLIILSFWAVILVLYQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50336785
n/a
NameBDBM50336785
Synonyms:CHEMBL606414 | sodium 1-amino-4-(cyclohexylamino)-9,10-dioxo-9,10-dihydroanthracene-2-sulfonate
TypeSmall organic molecule
Emp. Form.C20H19N2O5S
Mol. Mass.399.441
SMILESNc1c(cc(NC2CCCCC2)c2C(=O)c3ccccc3C(=O)c12)S([O-])(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: