Reaction Details |
| Report a problem with these data |
Target | Farnesyl pyrophosphate synthase |
---|
Ligand | BDBM25308 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_631176 (CHEMBL1109110) |
---|
IC50 | 3±n/a nM |
---|
Citation | McKenna, CE; Kashemirov, BA; Blazewska, KM; Mallard-Favier, I; Stewart, CA; Rojas, J; Lundy, MW; Ebetino, FH; Baron, RA; Dunford, JE; Kirsten, ML; Seabra, MC; Bala, JL; Marma, MS; Rogers, MJ; Coxon, FP Synthesis, chiral high performance liquid chromatographic resolution and enantiospecific activity of a potent new geranylgeranyl transferase inhibitor, 2-hydroxy-3-imidazo[1,2-a]pyridin-3-yl-2-phosphonopropionic acid. J Med Chem53:3454-64 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Farnesyl pyrophosphate synthase |
---|
Name: | Farnesyl pyrophosphate synthase |
Synonyms: | Dimethylallyltranstransferase | FDPS | FPP synthase | FPP synthetase | FPPS_HUMAN | FPS | Farnesyl diphosphate synthase | Farnesyl diphosphate synthase (FPPS) | Farnesyl diphosphate synthetase | Farnesyl pyrophosphate synthase (FPPS) | Farnesyl pyrophosphate synthetase | Geranyltranstransferase | KIAA1293 | P14324 |
Type: | Enzyme |
Mol. Mass.: | 48272.89 |
Organism: | Homo sapiens (Human) |
Description: | P14324 |
Residue: | 419 |
Sequence: | MPLSRWLRSVGVFLLPAPYWAPRERWLGSLRRPSLVHGYPVLAWHSARCWCQAWTEEPRA
LCSSLRMNGDQNSDVYAQEKQDFVQHFSQIVRVLTEDEMGHPEIGDAIARLKEVLEYNAI
GGKYNRGLTVVVAFRELVEPRKQDADSLQRAWTVGWCVELLQAFFLVADDIMDSSLTRRG
QICWYQKPGVGLDAINDANLLEACIYRLLKLYCREQPYYLNLIELFLQSSYQTEIGQTLD
LLTAPQGNVDLVRFTEKRYKSIVKYKTAFYSFYLPIAAAMYMAGIDGEKEHANAKKILLE
MGEFFQIQDDYLDLFGDPSVTGKIGTDIQDNKCSWLVVQCLQRATPEQYQILKENYGQKE
AEKVARVKALYEELDLPAVFLQYEEDSYSHIMALIEQYAAPLPPAVFLGLARKIYKRRK
|
|
|
BDBM25308 |
---|
n/a |
---|
Name | BDBM25308 |
Synonyms: | (1-hydroxy-2-{imidazo[1,2-a]pyridin-3-yl}-1-phosphonoethyl)phosphonic acid | bisphosphonate, 57 |
Type | Small organic molecule |
Emp. Form. | C9H12N2O7P2 |
Mol. Mass. | 322.1483 |
SMILES | OC(Cc1cnc2ccccn12)(P(O)(O)=O)P(O)(O)=O |
Structure |
|