| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Type-2 angiotensin II receptor |
|---|
| Ligand | BDBM50321074 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_637186 (CHEMBL1167160) |
|---|
| Ki | 3.5±n/a nM |
|---|
| Citation |  Mahalingam, AK; Wan, Y; Murugaiah, AM; Wallinder, C; Wu, X; Plouffe, B; Botros, M; Nyberg, F; Hallberg, A; Gallo-Payet, N; Alterman, M Selective angiotensin II AT(2) receptor agonists with reduced CYP 450 inhibition. Bioorg Med Chem18:4570-90 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Type-2 angiotensin II receptor |
|---|
| Name: | Type-2 angiotensin II receptor |
|---|
| Synonyms: | Angiotensin type II receptor |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 15474.49 |
|---|
| Organism: | Sus scrofa |
|---|
| Description: | ChEMBL_1285617 |
|---|
| Residue: | 137 |
|---|
| Sequence: | MAFPPEKYAQWSAGIALMKNILGFIIPLVFIATCYFGIRKHLLKTNSYGKNRITRDQVLN
MAAAVVLAFIICWLPFHVLTFLDALAWMGIINSCEVIAVIDLALPFAILLGFTNSCINPF
LYCFVGNRFQQKLRSVF
|
|
|
|---|
| BDBM50321074 |
|---|
| n/a |
|---|
| Name | BDBM50321074 |
|---|
| Synonyms: | CHEMBL1164870 | N-Butyloxycarbonyl-3-[4-(2-oxo-pyrrolidin-1-yl-methyl)-phenyl]-5-iso-butylthiophene-2-sulfonamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H32N2O5S2 |
|---|
| Mol. Mass. | 492.651 |
|---|
| SMILES | CCCCOC(=O)NS(=O)(=O)c1sc(CC(C)C)cc1-c1ccc(CN2CCCC2=O)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
