Reaction Details |
| Report a problem with these data |
Target | Delta-type opioid receptor |
---|
Ligand | BDBM50321607 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_639786 (CHEMBL1175731) |
---|
IC50 | 6.3±n/a nM |
---|
Citation | Lee, YS; Fernandes, S; Kulkarani, V; Mayorov, A; Davis, P; Ma, SW; Brown, K; Gillies, RJ; Lai, J; Porreca, F; Hruby, VJ Design and synthesis of trivalent ligands targeting opioid, cholecystokinin, and melanocortin receptors for the treatment of pain. Bioorg Med Chem Lett20:4080-4 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Delta-type opioid receptor |
---|
Name: | Delta-type opioid receptor |
Synonyms: | D-OR-1 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRD_HUMAN | OPRK1 | opioid receptor, delta 1 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 40382.98 |
Organism: | Homo sapiens (Human) |
Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor. |
Residue: | 372 |
Sequence: | MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
|
|
|
BDBM50321607 |
---|
n/a |
---|
Name | BDBM50321607 |
Synonyms: | (3S,6S,9S,12S,15R,18S,21S,27R,30S)-18-((1H-imidazol-5-yl)methyl)-9-((1H-indol-3-yl)methyl)-30-amino-3-((S)-1-amino-1-oxo-3-phenylpropan-2-ylcarbamoyl)-21-benzyl-6-butyl-12-(3-guanidinopropyl)-31-(4-hydroxyphenyl)-27-methyl-15-(naphthalen-2-ylmethyl)-5,8,11,14,17,20,23,26,29-nonaoxo-4,7,10,13,16,19,22,25,28-nonaazahentriacontan-1-oic acid | CHEMBL1172252 |
Type | Small organic molecule |
Emp. Form. | C78H94N18O14 |
Mol. Mass. | 1507.6932 |
SMILES | CCCC[C@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](Cc1ccc2ccccc2c1)NC(=O)[C@H](Cc1cnc[nH]1)NC(=O)[C@H](Cc1ccccc1)NC(=O)CNC(=O)[C@@H](C)NC(=O)[C@@H](N)Cc1ccc(O)cc1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](Cc1ccccc1)C(N)=O |r| |
Structure |
|