Reaction Details |
| Report a problem with these data |
Target | Ribosyldihydronicotinamide dehydrogenase [quinone] |
---|
Ligand | BDBM50131692 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_642470 (CHEMBL1175843) |
---|
IC50 | 1700±n/a nM |
---|
Citation | Sun, B; Hoshino, J; Jermihov, K; Marler, L; Pezzuto, JM; Mesecar, AD; Cushman, M Design, synthesis, and biological evaluation of resveratrol analogues as aromatase and quinone reductase 2 inhibitors for chemoprevention of cancer. Bioorg Med Chem18:5352-66 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Ribosyldihydronicotinamide dehydrogenase [quinone] |
---|
Name: | Ribosyldihydronicotinamide dehydrogenase [quinone] |
Synonyms: | Metallothionein-3 | NMOR2 | NQO2 | NQO2_HUMAN | NRH dehydrogenase [quinone] 2 | NRH:quinone oxidoreductase 2 | QR2 | Quinone reductase 2 | Quinone reductase 2 (NQO2) | Ribosyldihydronicotinamide dehydrogenase [quinone] |
Type: | Protein |
Mol. Mass.: | 25917.25 |
Organism: | Homo sapiens (Human) |
Description: | P16083 |
Residue: | 231 |
Sequence: | MAGKKVLIVYAHQEPKSFNGSLKNVAVDELSRQGCTVTVSDLYAMNLEPRATDKDITGTL
SNPEVFNYGVETHEAYKQRSLASDITDEQKKVREADLVIFQFPLYWFSVPAILKGWMDRV
LCQGFAFDIPGFYDSGLLQGKLALLSVTTGGTAEMYTKTGVNGDSRYFLWPLQHGTLHFC
GFKVLAPQISFAPEIASEEERKGMVAAWSQRLQTIWKEEPIPCTAHWHFGQ
|
|
|
BDBM50131692 |
---|
n/a |
---|
Name | BDBM50131692 |
Synonyms: | 3,5-Dimethoxy-4'-amino-trans-stilbene | 4-[2-(3,5-Dimethoxy-phenyl)-vinyl]-phenylamine | CHEMBL324290 | trans-3,5-dimethoxyl-4'-aminostilbene |
Type | Small organic molecule |
Emp. Form. | C16H17NO2 |
Mol. Mass. | 255.3117 |
SMILES | COc1cc(OC)cc(\C=C\c2ccc(N)cc2)c1 |
Structure |
|