Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRibosyldihydronicotinamide dehydrogenase [quinone]
LigandBDBM50322046
Substrate/Competitorn/a
Meas. Tech.ChEMBL_642470
IC50 270±n/a nM
Citation Sun BHoshino JJermihov KMarler LPezzuto JMMesecar ADCushman M Design, synthesis, and biological evaluation of resveratrol analogues as aromatase and quinone reductase 2 inhibitors for chemoprevention of cancer. Bioorg Med Chem 18:5352-66 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Ribosyldihydronicotinamide dehydrogenase [quinone]
Name:Ribosyldihydronicotinamide dehydrogenase [quinone]
Synonyms:Metallothionein-3 | NRH dehydrogenase [quinone] 2 | NRH:quinone oxidoreductase 2 | QR2 | Quinone reductase 2 | Quinone reductase 2 (NQO2) | Ribosyldihydronicotinamide dehydrogenase [quinone]
Type:Protein
Mol. Mass.:25917.25
Organism:Homo sapiens (Human)
Description:P16083
Residue:231
Sequence:
MAGKKVLIVYAHQEPKSFNGSLKNVAVDELSRQGCTVTVSDLYAMNLEPRATDKDITGTL
SNPEVFNYGVETHEAYKQRSLASDITDEQKKVREADLVIFQFPLYWFSVPAILKGWMDRV
LCQGFAFDIPGFYDSGLLQGKLALLSVTTGGTAEMYTKTGVNGDSRYFLWPLQHGTLHFC
GFKVLAPQISFAPEIASEEERKGMVAAWSQRLQTIWKEEPIPCTAHWHFGQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50322046
n/a
NameBDBM50322046
Synonyms:3,4,5-Trimethoxy-4'-amino-trans-stilbene | 4-[2-(3,4,5-Trimethoxy-phenyl)-vinyl]-phenylamine | CHEMBL87477
TypeSmall organic molecule
Emp. Form.C17H19NO3
Mol. Mass.285.3377
SMILESCOc1cc(\C=C\c2ccc(N)cc2)cc(OC)c1OC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: