Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSialidase 4
LigandBDBM4994
Substrate/Competitorn/a
Meas. Tech.ChEMBL_679990
IC50>10000000±n/a nM
Citation Hata KKoseki KYamaguchi KMoriya SSuzuki YYingsakmongkon SHirai GSodeoka Mvon Itzstein MMiyagi T Limited inhibitory effects of oseltamivir and zanamivir on human sialidases. Antimicrob Agents Chemother 52:3484-91 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sialidase 4
Name:Sialidase 4
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:51579.82
Organism:Homo sapiens (Human)
Description:ChEMBL_960637
Residue:484
Sequence:
MGVPRTPSRTVLFERERTGLTYRVPSLLPVPPGPTLLAFVEQRLSPDDSHAHRLVLRRGT
LAGGSVRWGALHVLGTAALAEHRSMNPCPVHDAGTGTVFLFFIAVLGHTPEAVQIATGRN
AARLCCVASRDAGLSWGSARDLTEEAIGGAVQDWATFAVGPGHGVQLPSGRLLVPAYTYR
VDRRECFGKICRTSPHSFAFYSDDHGRTWRCGGLVPNLRSGECQLAAVDGGQAGSFLYCN
ARSPLGSRVQALSTDEGTSFLPAERVASLPETAWGCQGSIVGFPAPAPNRPRDDSWSVGP
GSPLQPPLLGPGVHEPPEEAAVDPRGGQVPGGPFSRLQPRGDGPRQPGPRPGVSGDVGSW
TLALPMPFAAPPQSPTWLLYSHPVGRRARLHMGIRLSQSPLDPRSWTEPWVIYEGPSGYS
DLASIGPAPEGGLVFACLYESGARTSYDEISFCTFSLREVLENVPASPKPPNLGDKPRGC
CWPS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM4994
n/a
NameBDBM4994
Synonyms:(3R,4R,5S)-5-amino-4-acetamido-3-(pentan-3-yloxy)cyclohex-1-ene-1-carboxylic acid | CHEMBL674 | GS4071 | Oseltamivir carboxylate
TypeSmall organic molecule
Emp. Form.C14H24N2O4
Mol. Mass.284.3514
SMILESCCC(CC)O[C@@H]1C=C(C[C@H](N)[C@H]1NC(C)=O)C(O)=O |r,c:7|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: