| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Serine/threonine-protein kinase pim-1 |
|---|
| Ligand | BDBM26670 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_819566 (CHEMBL2033650) |
|---|
| IC50 | 550±n/a nM |
|---|
| Citation |  Good, AC; Liu, J; Hirth, B; Asmussen, G; Xiang, Y; Biemann, HP; Bishop, KA; Fremgen, T; Fitzgerald, M; Gladysheva, T; Jain, A; Jancsics, K; Metz, M; Papoulis, A; Skerlj, R; Stepp, JD; Wei, RR Implications of promiscuous Pim-1 kinase fragment inhibitor hydrophobic interactions for fragment-based drug design. J Med Chem55:2641-8 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Serine/threonine-protein kinase pim-1 |
|---|
| Name: | Serine/threonine-protein kinase pim-1 |
|---|
| Synonyms: | PIM-1 Kinase | PIM1 | PIM1_HUMAN | Proto-oncogene serine/threonine-protein kinase Pim-1 | Serine/threonine-protein kinase (PIM1) | Serine/threonine-protein kinase PIM | Serine/threonine-protein kinase PIM1 | Serine/threonine-protein kinase pim-1 (PIM1) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 35681.82 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P11309 |
|---|
| Residue: | 313 |
|---|
| Sequence: | MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSD
NLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLIL
ERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRG
ELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI
PFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETA
EIHLHSLSPGPSK
|
|
|
|---|
| BDBM26670 |
|---|
| n/a |
|---|
| Name | BDBM26670 |
|---|
| Synonyms: | 2,3-diphenyl-1H-indole-7-carboxylic acid | cid_5003498 | diphenylindole carboxylic acid, 3 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H15NO2 |
|---|
| Mol. Mass. | 313.3493 |
|---|
| SMILES | OC(=O)c1cccc2c(c([nH]c12)-c1ccccc1)-c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
