| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial |
|---|
| Ligand | BDBM50386612 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_826232 (CHEMBL2049243) |
|---|
| IC50 | >1000±n/a nM |
|---|
| Citation |  Miyakoshi, H; Miyahara, S; Yokogawa, T; Chong, KT; Taguchi, J; Endoh, K; Yano, W; Wakasa, T; Ueno, H; Takao, Y; Nomura, M; Shuto, S; Nagasawa, H; Fukuoka, M Synthesis and discovery of N-carbonylpyrrolidine- or N-sulfonylpyrrolidine-containing uracil derivatives as potent human deoxyuridine triphosphatase inhibitors. J Med Chem55:2960-9 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial |
|---|
| Name: | Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial |
|---|
| Synonyms: | DUT | DUT_HUMAN | Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) | Deoxyuridine triphosphatase (dUTPase) | dUTP pyrophosphatase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 26574.03 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P33316 |
|---|
| Residue: | 252 |
|---|
| Sequence: | MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSA
GRLSQGCRGASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLS
EHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKH
FIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTE
RGSGGFGSTGKN
|
|
|
|---|
| BDBM50386612 |
|---|
| n/a |
|---|
| Name | BDBM50386612 |
|---|
| Synonyms: | CHEMBL2048478 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H25N3O4 |
|---|
| Mol. Mass. | 419.473 |
|---|
| SMILES | OC([C@@H]1CCCN1C(=O)CCn1ccc(=O)[nH]c1=O)(c1ccccc1)c1ccccc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
