Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCorticotropin releasing factor receptor
LigandBDBM50387617
Substrate/Competitorn/a
Meas. Tech.ChEMBL_830642
IC50 2.1±n/a nM
Citation Dzierba CDSielecki TMArvanitis AGGalka AJohnson TLTakvorian AGRafalski MKasireddy-Polam PVig SDasgupta BZhang GMolski TFWong HZaczek RCLodge NJCombs APGilligan PJTrainor GLBronson JJMacor JE Synthesis and structure-activity relationships of pyrido[3,2-b]pyrazin-3(4H)-ones and pteridin-7(8H)-ones as corticotropin-releasing factor-1 receptor antagonists. Bioorg Med Chem Lett 22:4986-9 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Corticotropin releasing factor receptor
Name:Corticotropin releasing factor receptor
Synonyms:CRF-R | CRF1 | CRH-R 1 | CRHR1 | Corticotropin releasing factor receptor 1 | Corticotropin-releasing Factor Receptor 1 | Corticotropin-releasing hormone receptor 1
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:47870.75
Organism:Rattus norvegicus (rat)
Description:Receptor binding assays were performed using rat cortex homogenate.
Residue:415
Sequence:
MGRRPQLRLVKALLLLGLNPVSTSLQDQRCENLSLTSNVSGLQCNASVDLIGTCWPRSPA
GQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAV
IINYLGHCISLVALLVAFVLFLRLRSIRCLRNIIHWNLISAFILRNATWFVVQLTVSPEV
HQSNVAWCRLVTAAYNYFHVTNFFWMFGEGCYLHTAIVLTYSTDRLRKWMFVCIGWGVPF
PIIVAWAIGKLHYDNEKCWFGKRPGVYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRA
STTSETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDEVSRVVFIYFNSFLESFQGFFVS
VFYCFLNSEVRSAIRKRWRRWQDKHSIRARVARAMSIPTSPTRVSFHSIKQSTAV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50387617
n/a
NameBDBM50387617
Synonyms:CHEMBL2057478
TypeSmall organic molecule
Emp. Form.C20H21ClFN3O3
Mol. Mass.405.85
SMILESCCC(COC)n1c2nccc(-c3cc(F)c(OC)cc3Cl)c2nc(C)c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: