| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Fibroblast growth factor 1 |
|---|
| Ligand | BDBM50388344 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_829712 (CHEMBL2061152) |
|---|
| Kd | 270±n/a nM |
|---|
| Citation |  Ferro, V; Liu, L; Johnstone, KD; Wimmer, N; Karoli, T; Handley, P; Rowley, J; Dredge, K; Li, CP; Hammond, E; Davis, K; Sarimaa, L; Harenberg, J; Bytheway, I Discovery of PG545: a highly potent and simultaneous inhibitor of angiogenesis, tumor growth, and metastasis. J Med Chem55:3804-13 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Fibroblast growth factor 1 |
|---|
| Name: | Fibroblast growth factor 1 |
|---|
| Synonyms: | Acidic fibroblast growth factor | Beta-endothelial cell growth factor | ECGF-beta | FGF1 | FGF1_HUMAN | FGFA | Fibroblast growth factor 1 (FGF-1) | HBGF-1 | Heparin-binding growth factor 1 | aFGF |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 17461.01 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P05230 |
|---|
| Residue: | 155 |
|---|
| Sequence: | MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
|
|
|
|---|
| BDBM50388344 |
|---|
| n/a |
|---|
| Name | BDBM50388344 |
|---|
| Synonyms: | CHEMBL2059244 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C39H61O32S7 |
|---|
| Mol. Mass. | 1266.341 |
|---|
| SMILES | CC(C)CCC[C@@H](C)[C@H]1CC[C@H]2[C@@H]3CC[C@H]4C[C@H](CC[C@]4(C)[C@H]3CC[C@]12C)O[C@H]1O[C@H](COS([O-])(=O)=O)[C@@H](OS([O-])(=O)=O)[C@H](OS([O-])(=O)=O)[C@@H]1O[C@H]1O[C@H](COS([O-])(=O)=O)[C@@H](OS([O-])(=O)=O)[C@H](OS([O-])(=O)=O)[C@@H]1OS([O-])(=O)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
