Reaction Details |
| Report a problem with these data |
Target | Translocator protein |
---|
Ligand | BDBM50388423 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_829916 (CHEMBL2061564) |
---|
Ki | 2.2±n/a nM |
---|
Citation | Castellano, S; Taliani, S; Milite, C; Pugliesi, I; Da Pozzo, E; Rizzetto, E; Bendinelli, S; Costa, B; Cosconati, S; Greco, G; Novellino, E; Sbardella, G; Stefancich, G; Martini, C; Da Settimo, F Synthesis and biological evaluation of 4-phenylquinazoline-2-carboxamides designed as a novel class of potent ligands of the translocator protein. J Med Chem55:4506-10 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Translocator protein |
---|
Name: | Translocator protein |
Synonyms: | Benzodiazepine receptors; peripheral & central | Bzrp | Mbr | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR) | Peripheral-Type Benzodiazepine Receptor | TSPO_RAT | Tspo |
Type: | Mitochondrion membrane protein |
Mol. Mass.: | 18945.84 |
Organism: | Rattus norvegicus (rat) |
Description: | Competitive binding experiments were performed on rat kidney mitochondrial membranes. |
Residue: | 169 |
Sequence: | MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
|
|
|
BDBM50388423 |
---|
n/a |
---|
Name | BDBM50388423 |
Synonyms: | CHEMBL2059061 |
Type | Small organic molecule |
Emp. Form. | C20H20ClN3O |
Mol. Mass. | 353.845 |
SMILES | CC[C@H](C)N(C)C(=O)c1nc(-c2ccccc2Cl)c2ccccc2n1 |r| |
Structure |
|